Adiponectin Protein (NBC1-18447)
Adiponectin Protein
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-gAcrp30 antibody, |
|
|
Adiponectin Protein Summary: | | Gene: | ADIPOQ |
|---|
| Purity: | Protein |
|---|
| | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Adiponectin Products Adiponectin Protein Details: | Immunogen: | MAYMYRSAFSVGLETRVTVPNVPIRFTKIF YNQQNHYDGSTGKFYCNIPGLYYFSYHITV YMKDVKVSLFKKDKAVLFTYDQYQEKNVDQ ASGSVLLHLEVGDQVWLQVYGDGDHNGLYA DNVNDSTFTGFLLYHDTN |
|---|
| Uses: | This product is useful as positive control for ELISA and SDS-Page. Purity is > 95 % by SDS-Page. |
|---|
| Dilutions: | Western Blot |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | 1.0 mg/ml |
|---|
|
Packaging: | Storage: | Store at -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Liquid. In 20mM Tris-HCl pH7.5, 50mM NaCl, 5mM DTT, 10% Glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Adiponectin/Acrp30(247amino acids) is adipocyte complement-related protein of 30kDa and exclusively expressed in differentiated adipocytes. Adiponectin(Acrp30) is a member of the complement factor C1q family and consists of signal sequence, Non-homologous sequence, collagen domain and globular domain(gAcrp30). Adiponectin(Acrp30) expression is reduced in a variety of obese and insulin-resistant states in human, monkeys and mice. Injection of Acrp30(247aa) or gAcrp30(globular domain) lowers serum glucose and free fatty acid level in mice. The globular domain of adiponectin/acrp30(amino acid residues, 111-247, gAcrp30) was overexpressed in E.coli and purified by using conventional chromatography techniques.
|
Images (1) Reviews (0) Related Products (84) Exploring Adiponectin Working with Adiponectin
|
Jump to: Publications, Images, Ask a Question
|
Working with Adiponectin
Adiponectin Protein Images (1) SDS-Page: Adiponectin Protein [NBC1-18447] - Adiponectin, 16 kDa (138 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE |
|
|
|
Publications (4)Adiponectin Protein Background References:- Yamauchi. T., et al(2002) Nature Med????
- Yamauchi T., et al(2001) Nature Medicine 7(8) 941-946Berg AH, et al(2001) Nature Medicine 7(8) 947-952
more... - Das,K., et al(2001) Biochem. Biophys.Res.Commun. 280(4)1120-1129
- Joachim Fruebis, et al(2001) PNAS 98(4) 2005-2010
|
|
|
|
Ask a Scientist
Can't find an answer to your question about Adiponectin? Ask us by using live
chat or by submitting your questions below:
|
|
