Home » Adenylate Kinase 1 » Adenylate Kinase 1 Proteins » Recombinant Human Adenylate Kinase 1 Protein

We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Register on R&D Systems

Recombinant Human Adenylate Kinase 1 Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related Adenylate Kinase 1 Peptides and Proteins

Order Details


    • Catalog Number
      H00000203-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Adenylate Kinase 1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-194 of Human AK1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
Protein/Peptide Type
Recombinant Protein
Gene
AK1

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Adenylate Kinase 1 Protein

  • Adenylate Kinase 1
  • adenylate kinase isoenzyme 1
  • AK 1
  • AK1
  • ATP-AMP transphosphorylase 1
  • EC 2.7.4
  • EC 2.7.4.3
  • EC 2.7.4.6
  • Myokinase

Background

AK1( AAH01116, 1 a.a. - 195 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ADK Antibody
NBP2-15291
Immunohistochemistry-Paraffin ADK Antibody
Western Blot ADK Antibody
Western Blot ADK Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
Adenosine
Deaminase/ADA Antibod ...
NBP1-87404
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody - BSA Free
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Adenosine Deaminase/ADA Antibody - BSA Free
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AK2 Antibody - BSA
Free
NBP1-33160
Western Blot AK2 Antibody - BSA Free
Immunohistochemistry-Paraffin AK2 Antibody - BSA Free
Western Blot AK2 Antibody - BSA Free
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
PGM1 Antibody
(3B8-H4) - Azide and ...
H00005236-M01
Western Blot PGM1 Antibody (3B8-H4) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence PGM1 Antibody (3B8-H4) - Azide and BSA Free
Immunoprecipitation PGM1 Antibody (3B8-H4) - Azide and BSA Free
(2 Publications)
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
PGD Antibody - BSA
Free
NBP1-31589
Western Blot PGD Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PGD Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PGD Antibody - BSA Free
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
ESD Antibody - BSA
Free
NBP2-16374
Immunohistochemistry-Paraffin ESD Antibody - BSA Free
Western Blot ESD Antibody - BSA Free
Western Blot ESD Antibody - BSA Free
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
LMW-PTP/ACP1
Antibody
AF5075
Western Blot LMW-PTP/ACP1 Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: WB
Lewis A Blood
Group Antigen Antibod ...
NB500-525
Immunohistochemistry Lewis A Blood Group Antigen Antibody (7LE) - BSA Free
Immunohistochemistry-Paraffin Lewis A Blood Group Antigen Antibody (7LE) - BSA Free
Immunohistochemistry-Paraffin Lewis A Blood Group Antigen Antibody (7LE) - BSA Free
(2 Publications)
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
AK3L1 Antibody
(OTI3B1)
NBP2-00827
Flow Cytometry AK3L1 Antibody (OTI3B1)
Western Blot AK3L1 Antibody (OTI3B1)
Immunohistochemistry-Paraffin AK3L1 Antibody (OTI3B1)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
Glyoxalase I
Antibody (Glo1a) - BS ...
NBP1-19015
Simple Western Glyoxalase I Antibody (Glo1a) - BSA Free
Western Blot Glyoxalase I Antibody (Glo1a) - BSA Free
Immunocytochemistry/ Immunofluorescence Glyoxalase I Antibody (Glo1a) - BSA Free
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF,  IHC-P, IP, Simple Western, WB
AK3 Antibody
(SJB3-36) - BSA Free
NBP1-04261
Immunohistochemistry-Paraffin AK3 Antibody (SJB3-36) - BSA Free
Flow Cytometry AK3 Antibody (SJB3-36) - BSA Free
Immunocytochemistry/ Immunofluorescence AK3 Antibody (SJB3-36) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
PHGDH Antibody -
BSA Free
NBP1-87311
Western Blot PHGDH Antibody - BSA Free
Western Blot PHGDH Antibody - BSA Free
Simple Western PHGDH Antibody - BSA Free
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
Haptoglobin [HRP]
DHAPG0
N/A Haptoglobin [HRP]
N/A Haptoglobin [HRP]
(7 Publications)
Species: Hu
Applications: ELISA
DLC1 Antibody -
Isoform 1 and 3
NB300-917
Immunofluorescence DLC1 Antibody - Isoform 1 and 3
Immunofluorescence DLC1 Antibody - Isoform 1 and 3
Immunohistochemistry-Paraffin DLC1 Antibody - Isoform 1 and 3
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
Holo-Transferrin
[Unconjugated]
2914-HT
Holo-Transferrin [Unconjugated]
(56 Publications)
Species: Hu
Applications: BA
PGM2 Antibody -
BSA Free
NBP2-32601
Immunocytochemistry/ Immunofluorescence PGM2 Antibody - BSA Free
Western Blot PGM2 Antibody - BSA Free
Immunohistochemistry PGM2 Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
GPT Antibody - BSA
Free
NBP1-89111
Western Blot GPT Antibody - BSA Free
Immunohistochemistry-Paraffin GPT Antibody - BSA Free
Immunohistochemistry-Paraffin GPT Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
Choline Kinase
beta Antibody - BSA F
NBP1-85632
Immunocytochemistry/ Immunofluorescence Choline Kinase beta Antibody - BSA Free
Immunohistochemistry-Paraffin Choline Kinase beta Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
Choline kinase
alpha Antibody - BSA ...
NBP1-85630
Western Blot Choline kinase alpha Antibody - BSA Free
Immunohistochemistry-Paraffin Choline kinase alpha Antibody - BSA Free
Immunohistochemistry-Paraffin Choline kinase alpha Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: IHC,  IHC-P, WB
DPAGT1 Antibody -
BSA Free
NBP2-81923
Western Blot DPAGT1 Antibody - BSA Free
Immunohistochemistry DPAGT1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence DPAGT1 Antibody - BSA Free
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for Adenylate Kinase 1 Recombinant Protein (H00000203-P01) (0)

There are no publications for Adenylate Kinase 1 Recombinant Protein (H00000203-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenylate Kinase 1 Recombinant Protein (H00000203-P01) (0)

There are no reviews for Adenylate Kinase 1 Recombinant Protein (H00000203-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adenylate Kinase 1 Recombinant Protein (H00000203-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Adenylate Kinase 1 Products

Blogs on Adenylate Kinase 1

There are no specific blogs for Adenylate Kinase 1, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Adenylate Kinase 1 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol AK1