Actin Alpha 2 Smooth Muscle Antibody (H00000059-M02)
Actin Alpha 2 Smooth Muscle Antibody (4A8-2H3)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ACTSA antibody, |
|
|
Actin Alpha 2 Smooth Muscle Antibody (4A8-2H3) Summary: | | Gene: | ACTA2 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ACTA2 (4A8-2H3) |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Actin Alpha 2 Smooth Muscle Products Actin Alpha 2 Smooth Muscle Antibody (4A8-2H3) Details: | Clone: | 4A8-2H3 |
|---|
| Isotype: | IgG2b Kappa |
|---|
| Immunogen: | ACTA2 (AAH17554, 1 a.a. ~ 378 a.a) full length recombinant protein with GST tag. |
|---|
| Epitope: | MCEEEDSTALVCDNGSGLCKAGFAGDDAPR AVFPSIVGRPRHQGVMVGMGQKDSYVGDEA QSKRGILTLKYPIEHGIITNWDDMEKIWHH SFYNELRVAPEEHPTLLTEAPLNPKANREK MTQIMFETFNVPAMYVAIQAVLSLYASGRT TGIVLDSGDGVTHNVPIYEGYALPHAIMRL DLAGRDLTDYLMKILTERGYSFVTTAEREI VRDIKEKLCYVALDFENEMATAASSSSLEK SYELPDGQVITIGNE |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against tissue lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Actin alpha 2, the human aortic smooth muscle actin gene, is one of six different actin isoforms which have been identified. Actins are highly conserved proteins that are involved in cell motility, structure and integrity. Alpha actins are a major constituent of the contractile apparatus.
|
Images (3) Reviews (0) Related Products (21) Exploring Actin Alpha 2 Smooth Muscle
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (12)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Actin Alpha 2 Smooth Muscle Antibody | NB600-531 | Bb, Bv, Ch, Hu, Mu, Po, Rb, Rt | ELISA, IHC-P, WB | (1) | (3) | | | | Actin Alpha 2 Smooth Muscle Antibody (1A4) | NB600-536 | Bb, Hu, Mk, Mu, Rb, Rt | ELISA, ICC, IF, IHC-P, WB | (1) | (3) | | | | Actin Alpha 2 Smooth Muscle Antibody | NB300-978 | Hu, Mu, Rt | IHC-P, PEP-ELISA, WB | (1) | (4) | | | | Actin Alpha 2 Smooth Muscle Antibody (HHF35) | NB100-65713 | Ch, Hu, Mk, Po, Rb, Rt, Ze | ELISA, IB, IHC-Fr, IHC-P | | (8) | | | | Actin Alpha 2 Smooth Muscle Antibody | NB600-1434 | Bv, Ch, Hu, Mk, Mu, Rb, Rt | IHC-P | (1) | | | | | ... and 7 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| Actin Alpha 2 Smooth Muscle in Context
Research Areas related to Actin Alpha 2 Smooth Muscle (3): |
|
Novus Explorer for Actin Alpha 2 Smooth Muscle gene
|
|
![Immunoperoxidase of monoclonal antibody to ACTA2 (H00000059-M02) on formalin-fixed paraffin-embedded human . [antibody concentration ug/ml]](http://images.novusbio.com/images/H00000059-M02-4-1-1-S.jpg "Immunoperoxidase of monoclonal antibody to ACTA2 (H00000059-M02) on formalin-fixed paraffin-embedded human . [antibody concentration ug/ml]")
