ATP6V0A1 Antibody (H00000535-A01)

ATP6V0A1 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 ml
 
Bulk Request
ATP6V0A1 Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:ATP6V0A1
Purity:Whole antisera
Host:Mouse
Specificity:ATP6V0A1 - ATPase, H+ transporting, lysosomal V0 subunit a isoform 1
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional ATP6V0A1 Products
ATP6V0A1 Antibody Details:
Immunogen:ATP6V0A1 (NP_005168, 212 a.a. ~ 299 a.a) partial recombinant protein with GST tag.
Epitope:GDYVHKSVFIIFFQGDQLKNRVKKICEGFR ASLYPCPETPQERKEMASGVNTRIDDLQMV LNQTEDHRQRVLQAAAKNIRVWFIKVR*
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500
Dilutions:ELISA, Western Blot 1:500
Unit Size:0.05 ml
Concentration:This product is unpurified. Concentration is not relevant.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol.
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: ATP6V0A1
Entrez535 (Human)
OMIM192130 (Human)
Swiss ProtNP_005168 (Human)
 
Background:

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three A subunit proteins and the encoded protein is associated with clathrin-coated vesicles. The occurrence of splice variants encoding different protein products has been reported, but the full-length natures of these transcripts have not been determined.

Jump to: Ask a Question

Working with ATP6V0A1

ATP6V0A1 Antibody Images (0)
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about ATP6V0A1? Ask us by using live chat or by submitting your questions below:

 
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ATP6V0A1 Partial Recombinant ProteinH00000535-Q01HuELISA, WB(1)

ATP6V0A1 Recombinant ProteinH00000535-P01HuELISA, WB(1)

Primary Antibodies (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ATP6V0A1 AntibodyNBP1-89342HuIF, IHC-P, WB(2)

ATP6V0A1 AntibodyNBP1-59949Hu, Mu, RtWB(1)

RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ATP6V0A1 RNAiH00000535-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer

ATP6V0A1 in Context


Novus Explorer for ATP6V0A1 gene

Try our bioinformatic tool that shows the relationships between ATP6V0A1 and other genes, diseases, pathways and post-translational modifications.