ATG7 Antibody (H00010533-D01P)
ATG7 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-APG7-LIKE antibody, anti-GSA7 antibody, anti-DKFZp434N0735 antibody, anti-APG7L antibody, |
|
|
ATG7 Antibody Summary: | | Gene: | ATG7 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Rabbit |
|---|
| | Specificity: | Reacts with ATG7 autophagy related 7 homolog (S. cerevisiae). |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ATG7 Products ATG7 Antibody Details: | Immunogen: | ATG7 (NP_006386.1, 1 a.a. ~ 703 a.a) full-length human protein. |
|---|
| Epitope: | MAAATGDPGLSKLQFAPFSSALDVGFWHEL TQKKLNEYRLDEAPKDIKGYYYNGDSAGLP ARLTLEFSAFDMSAPTPARCCPAIGTLYNT NTLESFKTADKKLLLEQAANEIWESIKSGT ALENPVLLNKFLLLTFADLKKYHFYYWFCY PALCLPESLPLIQGPVGLDQRFSLKQIEAL ECAYDNLCQTEGVTALPYFLIKYDENMVLV SLLKHYSDFFQGQRTKITIGVYDPCNLAQY PGWPLRNFLVLAAHR |
|---|
| Uses: | This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Store at -20 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene was identified based on homology to Pichia pastoris GSA7 and Saccharomyces cerevisiae APG7. In the yeast, the protein appears to be required for fusion of peroxisomal and vacuolar membranes. The protein shows homology to the ATP-binding and catalytic sites of the E1 ubiquitin activating enzymes. [provided by RefSeq]
|
Images (1) Reviews (0) Related Products (26) Exploring ATG7
|
Jump to: Images, Ask a Question
|
Working with ATG7
ATG7 Antibody Images (1) Western Blot analysis of ATG7 expression in transfected 293T cell line by ATG7 MaxPab rabbit polyclonal antibody.
Lane 1: ATG7 transfected lysate(78.00 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ATG7? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (14)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| ATG7 Antibody | R-161-100 | Hu, Rt | IF, IHC-P | (3) | (11) | | | | ATG7 Antibody (EP1759Y) | NB110-55474 | Hu, Mu(-), Rt(-) | FACS, ICC, IHC-P, IP, WB | (2) | (3) | | | | ATG7 Antibody | NB600-1274 | Hu | ELISA, IF, WB | | (3) | | | | Atg7 Antibody (EPR6251) | NBP1-95872 | Hu, Mu, Rt | ICC, IF, WB | (2) | | | | | ATG7 Antibody | NBP1-89042 | Hu | IF, IHC-P, WB | (2) | | | | | ... and 9 more. See All » |
Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Rabbit IgG Antibody [HRP] | NB730-H | Rb | ELISA, ICC, IHC-P, WB | | (5) | | | | Rabbit IgG Antibody [FITC] | NB730-F | Rb | ICC, IHC-P | | (1) | | | | Rabbit IgG Antibody [Biotin] | NB730-B | Rb | ELISA, ICC, IHC-P, WB | | | | | | Rabbit IgG, H/L Chains Antibody [DyLight 488] | NBP1-72944 | Rb | FLISA, IF, WB | (3) | | | | | Rabbit IgG Antibody [Alkaline Phosphatase] | NB730-AP | Rb | ELISA, ICC, IHC-P, WB | | (1) | | | | See All » |
|
|
