ATG7 Antibody (H00010533-B01)
ATG7 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-APG7L antibody, anti-GSA7 antibody |
|
|
ATG7 Antibody Summary: | | Gene: | ATG7 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ATG7 - ATG7 autophagy related 7 homolog (S. cerevisiae), |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ATG7 Products ATG7 Antibody Details: | Immunogen: | ATG7 (-, 1 a.a. ~ 703 a.a) full-length human protein. |
|---|
| Epitope: | MAAATGDPGLSKLQFAPFSSALDVGFWHEL TQKKLNEYRLDEAPKDIKGYYYNGDSAGLP ARLTLEFSAFDMSAPTPARCCPAIGTLYNT NTLESFKTADKKLLLEQAANEIWESIKSGT ALENPVLLNKFLLLTFADLKKYHFYYWFCY PALCLPESLPLIQGPVGLDQRFSLKQIEAL ECAYDNLCQTEGVTALPYFLIKYDENMVLV SLLKHYSDFFQGQRTKITIGVYDPCNLAQY PGWPLRNFLVLAAHR |
|---|
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This antibody is in antisera and the concentration is unavailable. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene was identified based on homology to Pichia pastoris GSA7 and Saccharomyces cerevisiae APG7. In the yeast, the protein appears to be required for fusion of peroxisomal and vaculuolar membranes. The protein shows homlogy to the ATP-binding and catalytic sites of the E1 ubiquitin activating enzymes.
|
Images (2) Reviews (0) Related Products (26) Exploring ATG7
|
Jump to: Images, Ask a Question
|
Working with ATG7
ATG7 Antibody Images (2) Western Blot analysis of ATG7 expression in transfected 293T cell line by ATG7 MaxPab polyclonal antibody (B01).
Lane 1: ATG7 transfected lysate(78.00 KDa).
Lane 2: Non-transfected lysate.
|  ATG7 MaxPab polyclonal antibody. Western Blot analysis of ATG7 expression in HepG2. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ATG7? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (14)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| ATG7 Antibody | R-161-100 | Hu, Rt | IF, IHC-P | (3) | (11) | | | | ATG7 Antibody (EP1759Y) | NB110-55474 | Hu, Mu(-), Rt(-) | FACS, ICC, IHC-P, IP, WB | (2) | (3) | | | | ATG7 Antibody | NB600-1274 | Hu | ELISA, IF, WB | | (3) | | | | Atg7 Antibody (EPR6251) | NBP1-95872 | Hu, Mu, Rt | ICC, IF, WB | (2) | | | | | ATG7 Antibody | NBP1-89042 | Hu | IF, IHC-P, WB | (2) | | | | | ... and 9 more. See All » |
Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
