Home » Products » Primary Antibodies » ATG5 Antibody (H00009474-M04) (0.1 mg)
 

ATG5 Antibody (H00009474-M04)

ATG5 Antibody (1G11)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
(see alternate names)
ATG5 Antibody (1G11) Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Monoclonal
Gene:ATG5
Purity:IgG purified
Host:Mouse
Specificity:ATG5 - ATG5 autophagy related 5 homolog (S. cerevisiae) (1G11)
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional ATG5 Products
LysatesPeptides and Proteins
Primary AntibodiesRNAi
 
» View all ATG5 Related Products
ATG5 Antibody (1G11) Details:
Clone:1G11
Isotype:IgG2a Kappa
Immunogen:ATG5 (AAH02699, 176 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Epitope:PAEENGFRYIPFRIYQTTTERPFIQKLFRP VAADGQLHTLGDLLKEVCPSAIDPEDGEKK NQVMIHGIEPMLETPLQWLSEHLSYPDNFL HISIIPQPTD
Species Reactivity:

Human.

Applications:
Uses:Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Dilutions:ELISA, Western Blot 1:500
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: ATG5
Entrez9474 (Human)
Swiss ProtAAH02699 (Human)
 
Images (3)
  • ATG5 monoclonal antibody (M04), clone 1G11. Western Blot analysis of ATG5 expression in Raw 264.7(Cat # L024V1 ).
  • ATG5 monoclonal antibody (M04), clone 1G11. Western Blot analysis of ATG5 expression in Jurkat ( Cat # L017V1 ).
  • ATG5 monoclonal antibody (M04), clone 1G11. Western Blot analysis of ATG5 expression in NIH/3T3(Cat # L018V1 ).

See all images...

Reviews (0)

Be the first to review this product for a reward!

Related Products (33)

1 Lysates

4 Peptides and Proteins

24 Primary Antibodies

1 RNAi

Secondary Antibodies

Exploring ATG5

2 Related Research Areas
Jump to: Images, Ask a Question

Working with ATG5

ATG5 Antibody (1G11) Images (3)
ATG5 monoclonal antibody (M04), clone 1G11. Western Blot analysis of ATG5 expression in Raw 264.7(Cat # L024V1 ).ATG5 monoclonal antibody (M04), clone 1G11. Western Blot analysis of ATG5 expression in Jurkat ( Cat # L017V1 ).
ATG5 monoclonal antibody (M04), clone 1G11. Western Blot analysis of ATG5 expression in NIH/3T3(Cat # L018V1 ).
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.
Protocols
All General Protocols

Ask a Scientist

Can't find an answer to your question about ATG5? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ATG5 LysateNBL1-07799WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ATG5 PeptideNB110-53818PEP

ATG5 Partial Recombinant ProteinH00009474-Q01HuELISA, WB(1)

ATG5 Recombinant ProteinH00009474-P01HuELISA, WB(1)

ATG5 ProteinNBP1-50982PAGE

Primary Antibodies (24)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ATG5 AntibodyNB110-53818Bv, Hu, Mk, Mu, Po, Rt, Xp, ZeIF, IHC-P, WB(3)(9)

ATG5 AntibodyR-111-100HuIF, IHC-P, WB(3)(2)

ATG5 AntibodyR-138-500HuIF, IHC-P, WB(1)

ATG5 AntibodyNBP1-76866Hu, Mu, RtELISA, IHC-P, WB(2)

ATG5 AntibodyNBP1-76992Hu, Mu, RtELISA, IHC-P, WB(2)

... and 19 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ATG5 RNAiH00009474-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »
Jump to: Novus Explorer, Research Areas

ATG5 in Context

Research Areas related to ATG5 (2):
Novus Explorer for ATG5 gene
Try our bioinformatic tool that shows the relationships between ATG5 and other genes, diseases, pathways and post-translational modifications.