ATF4 Antibody (H00000468-D01P)

ATF4 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
ATF4 Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:ATF4
Purity:Protein A purified
Host:Rabbit
Specificity:ATF4 - activating transcription factor 4 (tax-responsive enhancer element B67),
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional ATF4 Products
ATF4 Antibody Details:
Immunogen:ATF4 (NP_001666.2, 1 a.a. ~ 351 a.a) full-length human protein.
Epitope:MTEMSFLSSEVLVGDLMSPFDQSGLGAEES LGLLDDYLEVAKHFKPHGFSSDKAKAGSSE WLAVDGLVSPSNNSKEDAFSGTDWMLEKMD LKEFDLDALLGIDDLETMPDDLLTTLDDTC DLFAPLVQETNKQPPQTVNPIGHLPESLTK PDQVAPFTFLQPLPLSPGVLSSTPDHSFSL ELGSEVDITEGDRKPDYTAYVAMIPQCIKE EDTPSDNDSGICMSPESYLGSPQHSPSTRG SPNRSLPSPGVLCGS
Species Reactivity:

Human.

Applications:
Uses:Antibody reactive against recombinant protein with GST tag on ELISA and western blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: ATF4
Entrez468 (Human)
Swiss ProtNP_001666.2 (Human)
 
Background:

This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromsome at q28 in a region containing a large inverted duplication. [provided by RefSeq]

Jump to: Images, Ask a Question

Working with ATF4

ATF4 Antibody Images (1)
Western Blot analysis of ATF4 expression in transfected 293T cell line by ATF4 MaxPab rabbit polyclonal antibody.

Lane 1: ATF4 transfected lysate(38.60 KDa).
Lane 2: Non-transfected lysate.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about ATF4? Ask us by using live chat or by submitting your questions below:

 
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Antibody Pairs (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ATF4 Antibody PairH00000468-AP11HuELISA(1)(1)

ATF4 [p Ser245] Antibody PairDP0153HuPLA(4)

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ATF4 LysateNBL1-07790WB(1)

ATF4 LysateH00000468-T02WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ATF4 Recombinant ProteinH00000468-P02HuELISA, WB(1)

ATF4 ProteinNBP1-72383HuPAGE

ATF4 Partial Recombinant ProteinH00000468-Q01HuELISA, WB

Primary Antibodies (16)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ATF4 Antibody (2B3)H00000468-M01HuELISA, IF, WB(3)

ATF4 AntibodyNB100-852Hu, Mu, Po, RtPEP-ELISA(1)(1)

ATF4 AntibodyNB100-91671Hu, RtELISA, IHC-P(1)

ATF4 AntibodyNBP1-07125Hu, MuIHC-P, WB

ATF4 AntibodyPAB1151Bv, Hu, Mu, Po, RtELISA

... and 11 more. See All »
RNAi (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ATF4 RNAiH00000468-R01Hu(1)(4)

ATF4 RNAiH00000468-R02Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Rabbit IgG Antibody [HRP]NB730-HRbELISA, ICC, IHC-P, WB(5)

Rabbit IgG Antibody [FITC]NB730-FRbICC, IHC-P(1)

Rabbit IgG Antibody [Biotin]NB730-BRbELISA, ICC, IHC-P, WB

Rabbit IgG, H/L Chains Antibody [DyLight 488]NBP1-72944RbFLISA, IF, WB(3)

Rabbit IgG Antibody [Alkaline Phosphatase]NB730-APRbELISA, ICC, IHC-P, WB(1)

See All »

Jump to: Novus Explorer, Research Areas

ATF4 in Context


Research Areas related to ATF4 (1):
Novus Explorer for ATF4 gene

Try our bioinformatic tool that shows the relationships between ATF4 and other genes, diseases, pathways and post-translational modifications.