AKT1 Antibody (H00000207-M09)
AKT1 Antibody (6F11)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-C AKT antibody, anti-VAKT Murine Thymona Viral Oncogene 1 antibody, anti-vAKT Murine Thymoma Viral Oncogene Homolog 1 antibody, anti-V AKT Murine Thymoma Viral Oncogene Homolog 1 antibody, anti-RAC Serine/Threonine Protein Kinase antibody, anti-RAC PK Alpha antibody, anti-RAC antibody, anti-RAC alpha serine/threonine protein kinase antibody, anti-RAC Alpha antibody, anti-Protein Kinase B Alpha antibody, anti-PRKBA antibody, anti-PKBalpha antibody, anti-PKB antibody, anti-PKB alpha antibody, anti-PKB Akt antibody, anti-Oncogene AKT1 antibody, anti-Murine thymoma viral (vakt) oncogene homolog 1 antibody, anti-MGC9965 antibody, anti-CAKT antibody, |
|
|
AKT1 Antibody (6F11) Summary: | | Gene: | AKT1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | AKT1 - v-akt murine thymoma viral oncogene homolog 1 |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional AKT1 Products AKT1 Antibody (6F11) Details: | Clone: | 6F11 |
|---|
| Isotype: | IgG2a Lambda |
|---|
| Immunogen: | AKT1 (AAH00479, 1 a.a. ~ 481 a.a) full length recombinant protein with GST tag. |
|---|
| Localization: | Cytoplasmic, and nuclear after activation by integrin linked protein kinase 1 (ILK1). |
|---|
| Epitope: | MSDVAIVKEGWLHKRGEYIKTWRPRYFLLK NDGTFIGYKERP
QDVDQREAPLNNFSVA QCQLMKTERPRPNTFIIRCLQWTTVI
ER TFHVETPEEREEWTTAIQTVADGLKKQEEE EMDFRSGSPS
DNSGAEEMEVSLAKPKHR VTMNEFEYLKLLGKGTFGKVILVK
EKAT GRYYAMKILKKEVIVAKDEVAHTLTENRVL QNSRHPFL
TALKYSFQTHDRLCFVMEYA NGGELFFHLSRERVF |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Phosphate buffered saline, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Multiple alternatively spliced transcript variants have been found for this gene.
|
Images (6) Reviews (0) Related Products (105) Exploring AKT1
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (6)Lysates (2)Peptides and ProteinsPrimary Antibodies (55)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| AKT1 [p Ser473] Antibody | NB600-590 | Hu | ELISA, ICC, IF, IHC-P, WB | (6) | (1) | | | | AKT1 Antibody (2E11) | H00000207-M03 | Hu, Mu, Rt | ELISA, IF, IHC-P, WB | (7) | | | | | AKT1 Antibody | NB600-467 | Hu | ELISA, IF, IHC-P, WB | (4) | (1) | | | | AKT1 Antibody (Y89) | NB110-55448 | Hu, Mu, Rt | FACS, ICC, IHC-P, IP, WB | (2) | (1) | | | | AKT1 [p Ser473] Antibody (EP2109Y) | NB100-79891 | Hu, Mu, Rt(-) | ICC, IHC-P, WB | (3) | (4) | | | | ... and 50 more. See All » |
RNAi (5)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
![Immunofluorescence of monoclonal antibody to AKT1 ( Cat# H00000207-M09 ) on HeLa cell . [antibody concentration 10 ug/ml]](http://images.novusbio.com/images/H00000207-M09-4-1-1-S.jpg "Immunofluorescence of monoclonal antibody to AKT1 ( Cat# H00000207-M09 ) on HeLa cell . [antibody concentration 10 ug/ml]")
