AKT1 Antibody (H00000207-M01)

AKT1 Antibody (4C3)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
AKT1 Antibody (4C3) Summary:
Species:Hu
Applications:ELISA, RNAi, WB
Clonality:Monoclonal
Gene:AKT1
Purity:IgG purified
Host:Mouse
Specificity:AKT1 - v-akt murine thymoma viral oncogene homolog 1
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional AKT1 Products
AKT1 Antibody (4C3) Details:
Clone:4C3
Isotype:IgG2a Kappa
Immunogen:AKT1 (AAH00479, 381 a.a. ~ 481 a.a) partial recombinant protein with GST tag.
Localization:Cytoplasmic, and nuclear after activation by integrin linked protein kinase 1 (ILK1).
Epitope:SGLLKKDPKQRLGGGSEDAKEIMQHRFFAG IVWQHVYEKKLS PPFKPQVTSETDTRYF DEEFTAQMITITPPDQDDSMECVDSE RR PHFPQFSYSASGTA*
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against recombinant protein on ELISA. It has also been used for RNAi validation, and Western Blot.
Dilutions:ELISA, RNAi Validation, Western Blot
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:Phosphate buffered saline, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: AKT1
Entrez207 (Human)
OMIM164730, 181500,
Swiss ProtAAH00479 (Human)
 
Background:

The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Multiple alternatively spliced transcript variants have been found for this gene.

Jump to: Images, Ask a Question

Working with AKT1

AKT1 Antibody (4C3) Images (5)
Western blot analysis of AKT1 over-expressed 293 cell line. Lane 2 cotransfected with AKT1 Validated Chimera RNAi Lane 1 non-transfected control. Blot probed with H00000207-M01. GAPDH ( 36.1 kDa ) used as loading control.Western blot analysis of AKT1 over-expressed 293 cell line. Lane 2 cotransfected with AKT1 Validated Chimera RNAi. Lane 1 non-transfected control. Blot probed with H00000207-M01. GAPDH (36.1 kDa) used as loading control.
Western blot analysis of AKT1 over-expressed 293 cell line. Lane 2 cotransfected with AKT1 Validated Chimera RNAi Lane 1 non-transfected control. Blot probed with H00000207-M01. GAPDH (36.1 kDa) used as loading control.
Lane 1: AKT1 transfected lysate(55.7 KDa).
Lane 2: Non-transfected lysate.
"" />
"Western Blot analysis of AKT1 expression in transfected 293T cell line by AKT1 monoclonal antibody (M01), clone 4C3.

Lane 1: AKT1 transfected lysate(55.7 KDa).
Lane 2: Non-transfected lysate.
"
Detection limit for recombinant GST tagged AKT1 is approximately 0.03ng/ml as a capture antibody.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about AKT1? Ask us by using live chat or by submitting your questions below:

 
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Antibody Pairs (6)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
AKT1 [p Thr308, p Thr309] Antibody PairDP0247HuPLA(1)

AKT1 [p Tyr315] Antibody PairDP0245HuPLA(1)

AKT1 [p Thr450] Antibody PairDP0246HuPLA(1)

AKT1 Antibody PairH00000207-AP11HuELISA(1)

AKT1 [p Ser124] Antibody PairDP0114HuPLA(4)

... and 1 more. See All »
Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
AKT1 LysateNBL1-07441WB(1)

AKT1 LysateH00000207-T01WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
AKT1 ProteinP3835HuFunc, PAGE

AKT1 Partial Recombinant ProteinH00000207-Q02HuELISA, WB(1)

AKT1 Partial Recombinant ProteinH00000207-Q01HuELISA, WB(1)

AKT1 Recombinant ProteinH00000207-P01HuELISA, WB(1)

AKT1 ProteinP4185HuFunc, PAGE

Primary Antibodies (55)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
AKT1 [p Ser473] AntibodyNB600-590HuELISA, ICC, IF, IHC-P, WB(6)(1)

AKT1 Antibody (2E11)H00000207-M03Hu, Mu, RtELISA, IF, IHC-P, WB(7)

AKT1 AntibodyNB600-467HuELISA, IF, IHC-P, WB(4)(1)

AKT1 Antibody (Y89)NB110-55448Hu, Mu, RtFACS, ICC, IHC-P, IP, WB(2)(1)

AKT1 Antibody (6F11)H00000207-M09HuELISA, IF, WB(6)

... and 50 more. See All »
RNAi (5)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
AKT1 RNAiH00000207-R02VHu(2)(4)

AKT1 RNAiH00000207-R01VHu(2)(4)

AKT1 RNAiH00000207-R08Hu(1)(4)

AKT1 RNAiH00000207-R07Hu(1)(4)

AKT1 RNAiH00000207-R09Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

AKT1 in Context


Research Areas related to AKT1 (8):
Novus Explorer for AKT1 gene

Try our bioinformatic tool that shows the relationships between AKT1 and other genes, diseases, pathways and post-translational modifications.