ADAM32 Antibody (H00203102-B01)
ADAM32 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
|
|
ADAM32 Antibody Summary: | | Gene: | ADAM32 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ADAM32 - ADAM metallopeptidase domain 32, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ADAM32 Products ADAM32 Antibody Details: | Immunogen: | ADAM32 (AAH26169, 1 a.a. ~ 787 a.a) full-length human protein. |
|---|
| Epitope: | MFRLWLLLAGLCGLLASRPGFQNSLLQIVI PEKIQTNTNDSSEIEYEQISYIIPIDEKLY TVHLKQRYFLADNFMIYLYNQGSMNTYSSD IQTQCYYQGNIEGYPDSMVTLSTCSGLRGI LQFENVSYGIEPLESAVEFQHVLYKLKNED NDIAIFIDRSLKEQPMDDNIFISEKSEPAV PDLFPLYLEMHIVVDKTLYDYWGSDSMIVT NKVIEIVGLANSMFTQFKVTIVLSSLELWS DENKISTVGEADELL |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This is unpurified antiserum so it is not possible to supply the specific antibody concentration. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
|
Images (1) Reviews (0) Related Products (5) Exploring ADAM32
|
Jump to: Images, Ask a Question
|
Working with ADAM32
ADAM32 Antibody Images (1) Western Blot analysis of ADAM32 expression in transfected 293T cell line by ADAM32 MaxPab polyclonal antibody (B01).
Lane 1: ADAM32 transfected lysate(87.90 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ADAM32? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
