ADAM2 Antibody (H00002515-B01)
ADAM2 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-CRYN1 antibody, anti-PH-30b antibody, anti-PH30 antibody, anti-FTNB antibody, anti-CRYN2 antibody, |
|
|
ADAM2 Antibody Summary: | | Gene: | ADAM2 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ADAM2 - ADAM metallopeptidase domain 2 (fertilin beta), |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ADAM2 Products ADAM2 Antibody Details: | Immunogen: | ADAM2 (-, 1 a.a. ~ 579 a.a) full-length human protein. |
|---|
| Epitope: | MWRVLFLLSGLGGLRMDSNFDSLPVQITVP EKIRSIIKEGIESQASYKIVIEGKPYTVNL MQKNFLPHNFRVYSYSGTGIMKPLDQDFQN FCHYQGYIEGYPKSVVMVSTCTGLRGVLQF ENVSYGIEPLESSVGFEHVIYQVKHKKADV SLYNEKDIESRDLSFKLQSVEHPRTISLES LAVILAQLLSLSMGITYDDINKCQCSGAVC IMNPEAIHFSGVKIFSNCSFEDFAHFISKQ KSQCLHNQPRLDPFF |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This is unpurified antiserum so it is not possible to supply the specific antibody concentration. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.
|
Images (1) Reviews (0) Related Products (11)
|
Jump to: Images, Ask a Question
|
Working with ADAM2
ADAM2 Antibody Images (1) Western Blot analysis of ADAM2 expression in transfected 293T cell line by ADAM2 MaxPab polyclonal antibody (B01).
Lane 1: ADAM2 transfected lysate(64.80 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ADAM2? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (1)Peptides and ProteinsPrimary Antibodies (7)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
