ADAM12 Antibody (NBP1-82791) | Novus Biologicals

ADAM12 Antibody (NBP1-82791) (100 ul)

Additional Products Available View our ADAM12 products. Call 303-730-1950 for recommended products	Ordering Information:
	Catalog Number	NBP1-82791
	Size(s)	100 ul	Price:
	Availability
Why Choose Novus?	Bulk Quote
	View All ADAM12 Primary Antibodies

anti-disintegrin and metalloproteinase domain-containing protein 12 antibody, anti-EC 3.4.24.58 antibody, anti-MLTNA antibody, anti-EC 3.4.24 antibody, anti-MCMP antibody, anti-ADAM 12 antibody, anti-a disintegrin and metalloproteinase domain 12 (meltrin alpha) antibody, anti-Meltrin-alpha antibody, anti-MCMPMltna antibody, anti-MLTNEC 3.4.24.- antibody, anti-meltrin-alpha antibody, anti-ADAM metallopeptidase domain 12 antibody

ADAM12 Antibody Summary:

Species:	Hu	Gene:	ADAM12
Applications:	IF, IHC-P	Purity:	Immunogen affinity purified
Clonality:	Polyclonal	Host:	Rabbit
Publications:

View Additional ADAM12 Products

Antibody Pairs	Lysates
Peptides and Proteins	Primary Antibodies
RNAi
» View All ADAM12 Related Products

ADAM12 Antibody Details:

Isotype:	IgG
Immunogen:	The epitope recognized by this antibody maps to the antigen sequence: LLFTNKKTTIEKLRCVRPSRPPRGFQPCQA HLGHLGKGLMRKPPDSYPPKDNPRRLLQCQ NVDISRPLN

Species Reactivity:

Human

Applications:

Uses:	For ICH-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Dilutions:	Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunofluorescence 1 - 4 ug/ml
Unit Size:	100 ul
Concentration:	Please see the vial label for concentration.

Packaging:

Storage:	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Buffer:	PBS, pH 7.2, containing 40% glycerol
Preservative:	0.02% Sodium Azide
Limitations:	This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.

Gene Symbol: ADAM12

Related Genes:

Images (2)


View All Images...

Be the first to review this product for a reward!

Review this product now.

ADAM12 Antibody Images (2)

	Immunohistochemistry-Paraffin: ADAM12 Antibody [NBP1-82791] - Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

	Immunofluorescence: ADAM12 Antibody [NBP1-82791] Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & mitochondria.