ADAM12 Antibody (H00008038-B01)
ADAM12 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-MCMP antibody, anti-MLTNA antibody, anti-MLTN antibody, anti-MCMPMltna antibody, |
|
|
ADAM12 Antibody Summary: | | Gene: | ADAM12 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ADAM12 - ADAM metallopeptidase domain 12 (meltrin alpha), |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ADAM12 Products ADAM12 Antibody Details: | Immunogen: | ADAM12 (-, 1 a.a. ~ 737 a.a) full-length human protein. |
|---|
| Epitope: | MAARPLPVSPARALLLALAGALLAPCEARG VSLWNQGRADEVVSASVRSGDLWIPVKSFD SKNHPEVLNIRLQRESKELIINLERNEGLI ASSFTETHYLQDGTDVSLARNYTGHCYYHG HVRGYSDSAVSLSTCSGLRGLIVFENESYV LEPMKSATNRYKLFPAKKLKSVRGSCGSHH NTPNLAAKNVFPPPSQTWARRHKRETLKAT KYVELVIVADNREFQRQGKDLEKVKQRLIE IANHVDKFYRPLNIR |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This is unpurified antiserum so it is not possible to supply the specific antibody concentration. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene has two alternatively spliced transcripts: a shorter secreted form and a longer membrane-bound form. The shorter form is found to stimulate myogenesis.
|
Images (1) Reviews (0) Related Products (17)
|
Jump to: Images, Ask a Question
|
Working with ADAM12
ADAM12 Antibody Images (1) Western Blot analysis of ADAM12 expression in transfected 293T cell line by ADAM12 MaxPab polyclonal antibody (B01).
Lane 1: ADAM12 transfected lysate(80.40 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ADAM12? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (2)Peptides and ProteinsPrimary Antibodies (9)RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer
| ADAM12 in Context
|
Novus Explorer for ADAM12 gene
|
|
