Recombinant Human ADAM11 Protein Summary
| Description |
Recombinant protein with a N-terminal GST tagcorresponding to the amino acids 230 - 333 of Human ADAM11 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:GHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGR |
| Details of Functionality |
This protein is not active and should not be used for experiments requiring activity. |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
ADAM11 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Application Notes |
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human ADAM11 Protein
Background
ADAM11 - a disintegrin and metalloproteinase domain 11
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Mu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: WB, ELISA, MA, AP
Publications for ADAM11 Partial Recombinant Protein (H00004185-Q01) (0)
There are no publications for ADAM11 Partial Recombinant Protein (H00004185-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ADAM11 Partial Recombinant Protein (H00004185-Q01) (0)
There are no reviews for ADAM11 Partial Recombinant Protein (H00004185-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ADAM11 Partial Recombinant Protein (H00004185-Q01) (0)
Additional ADAM11 Products
Research Areas for ADAM11 Partial Recombinant Protein (H00004185-Q01)
Find related products by research area.
|
Blogs on ADAM11