ACTR2 Antibody (H00010097-B01)
ACTR2 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ARP2 antibody, |
|
|
ACTR2 Antibody Summary: | | Gene: | ACTR2 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ACTR2 - ARP2 actin-related protein 2 homolog (yeast), |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ACTR2 Products ACTR2 Antibody Details: | Immunogen: | ACTR2 (-, 1 a.a. ~ 339 a.a) full-length human protein. |
|---|
| Epitope: | MVGDEASELRSMLEVNYPMENGIVRNWDDM KHLWDYTFGPEKLNIDTRNCKILLTEPPMN PTKNREKIVEVMFETYQFSGVYVAIQAVLT LYAQGLLTGVVVDSGDGVTHICPVYEGFSL PHLTRRLDIAGRDITRYLIKLLLLRGYAFN HSADFETVRMIKEKLCYVGYNIEQEQKLAL ETTVLVESYTLPDGRIIKVGGERFEAPEAL FQPHLINVEGVGVAELLFNTIQAADIDTRS EFYKHIVLSGGSTMY |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This is unpurified antiserum so it is not possible to supply the specific antibody concentration. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. Two transcript variants encoding different isoforms have been found for this gene.
|
Images (1) Reviews (0) Related Products (13) Exploring ACTR2
|
Jump to: Images, Ask a Question
|
Working with ACTR2
ACTR2 Antibody Images (1) Western Blot analysis of ACTR2 expression in transfected 293T cell line by ACTR2 MaxPab polyclonal antibody (B01).
Lane 1: ACTR2 transfected lysate(38.80 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ACTR2? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (7)RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
