ACTR1A Antibody (H00010121-M08)
ACTR1A Antibody (3E5)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ARP1 antibody, |
|
|
ACTR1A Antibody (3E5) Summary: | | Gene: | ACTR1A |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ACTR1A - ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (3E5) |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ACTR1A Products ACTR1A Antibody (3E5) Details: | Clone: | 3E5 |
|---|
| Isotype: | IgG2a Kappa |
|---|
| Immunogen: | ACTR1A (NP_005727, 279 a.a. ~ 376 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
|---|
| Epitope: | LVFAIQKSDMDLRRTLFSNIVLSGGSTLFK GFGDRLLSEVKKLAPKDVKIRISAPQERLY STWIGGSILASLDTFKKMWVSKKEYEEDGA RSIHRKT* |
|---|
| Uses: | This antibody is useful for ELISA. |
|---|
| Dilutions: | ELISA |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. [provided by RefSeq]
|
Images (1) Reviews (0) Related Products (11)
|
Jump to: Images, Ask a Question
|
Working with ACTR1A
ACTR1A Antibody (3E5) Images (1) Detection limit for recombinant GST tagged ACTR1A is approximately 1ng/ml as a capture antibody. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ACTR1A? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (5)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer
| ACTR1A in Context
|
Novus Explorer for ACTR1A gene
|
|
