ACTL7A Antibody (H00010881-B01)

ACTL7A Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 ml
 
Bulk Request
ACTL7A Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:ACTL7A
Purity:Whole antisera
Host:Mouse
Specificity:ACTL7A - actin-like 7A,
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional ACTL7A Products
ACTL7A Antibody Details:
Immunogen:ACTL7A (1 a.a. ~ 435 a.a) full-length human protein.
Epitope:MWAPPAAIMGDGPTKKVGNQAPLQTQALQT ASLRDGPAKRAVWVRHTSSEPQEPTESKAA KERPKQEVTKAVVVDLGTGYCKCGFAGLPR PTHKISTTVGKPYMETAKTGDNRKETFVGQ ELNNTNVHLKLVNPLRHGIIVDWDTVQDIW EYLFRQEMKIAPEEHAVLVSDPPLSPHTNR EKYAEMLFEAFNTPAMHIAYQSRLSMYSYG RTSGLVVEVGHGVSYVVPIYEGYPLPSITG RLDYAGSDLTAYLLG
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.05 ml
Concentration:This product is unpurified. Concentration is not relevant.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:This is unpurified antiserum so it is not possible to supply the specific antibody concentration.
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: ACTL7A
Entrez10881 (Human)
Swiss ProtNP_006678.1 (Human)
 
Background:

The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7A), and related gene, ACTL7B, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7A gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. The ACTL7A gene is expressed in a wide variety of adult tissues, however, its exact function is not known.

Jump to: Images, Ask a Question

Working with ACTL7A

ACTL7A Antibody Images (1)
Western Blot analysis of ACTL7A expression in transfected 293T cell line by ACTL7A MaxPab polyclonal antibody (B01).

Lane 1: ACTL7A transfected lysate(48.60 KDa).
Lane 2: Non-transfected lysate.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about ACTL7A? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ACTL7A LysateH00010881-T01HuWB(2)

ACTL7A LysateNBL1-07279WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ACTL7A Recombinant ProteinH00010881-P01HuELISA, WB(1)

ACTL7A ProteinP3783HuPAGE

Primary Antibodies (5)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ACTL7A AntibodyNBP1-85979HuIF, IHC-P, WB(2)

ACTL7A AntibodyNBP1-86014HuIF, IHC-P, WB(2)

ACTL7A AntibodyPAB18530HuELISA, IHC-P, WB

ACTL7A AntibodyH00010881-B01PHuELISA, WB(1)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

ACTL7A in Context


Research Areas related to ACTL7A (1):
Novus Explorer for ACTL7A gene

Try our bioinformatic tool that shows the relationships between ACTL7A and other genes, diseases, pathways and post-translational modifications.