ACSM1 Antibody 0.1 ml

ACSM1 NBP1-91645

Contact Information

Choose a country to view pricing and purchasing information.

More on NBP1-91645

  • All ACSM1 Products
  • Alternate Names
     
  • Submit a Review

Ordering Information: NBP1-91645

Catalog NumberNBP1-91645
  • FormUnconjugated
  • Size(s)0.1 ml
  • Price, Shipping
    & Availability
     

     
  •  

ACSM1 Antibody Summary

 
Species Human
Tested Applications ICC/IF, IHC, IHC-P
Clonality Polyclonal
Host Rabbit
Gene ACSM1
Purity Immunogen affinity purified
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

ACSM1 Antibody Details

 
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDF TSIRFPALEHCYTGGEVVLPKDQEEWKRRTG

Species Reactivity

 
Human

Applications/Dilutions

 
Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20-1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes

For IHC-Paraffin, HIER pH 6 retrieval method is recommended.

Positive Controls

1 Positive Control

Product PDFs

Reviews

Earn rewards points by submitting your review for ACSM1 Antibody (NBP1-91645).
Submit a Review

Publications

Earn rewards if you have published using ACSM1 Antibody (NBP1-91645).
Submit a Publication

Protocols and FAQs

Controls & Support Products

Research Tools

View all ACSM1 Research Tools.

Packaging, Storage & Formulations

 
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer Phospate buffered saline, pH 7.2, containing 40% glycerol
Unit Size 0.1 ml
Concentration Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative 0.02% Sodium Azide
Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

 
Gene Symbol ACSM1
Entrez
Uniprot

Alternate Names for ACSM1

 
  • BUCS1
  • EC 6.2.1
  • Middle-chain acyl-CoA synthetase 1
  • LAE
  • Lipoate-activating enzyme
  • medium-chain acyl-CoA synthetase
  • Butyryl-coenzyme A synthetase 1
  • Butyrate CoA ligase
  • Butyrate--CoA ligase 1
  • acyl-coenzyme A synthetase ACSM1, mitochondrial
  • butyryl Coenzyme A synthetase 1
  • MACS1MGC150532
  • acyl-CoA synthetase medium-chain family member 1EC 6.2.1.2

Related Products by Gene