ACSM1 Antibody 0.1 ml

Click image to view larger
Immunocytochemistry/Immunofluorescence: ACSM1 Antibody [NBP1-91645] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: ACSM1 Antibody [NBP1-91645] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Download Datasheet
See All Related

Ordering Information: NBP1-91645

  • Catalog Number
  • Displayed Format
  • Size(s)
    0.1 ml
  • Availability
  • Price

ACSM1 Antibody Summary

Species Human
Tested Applications ICC/IF, IHC, IHC-P
Immunogen affinity purified
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

ACSM1 Antibody Details

This antibody was developed against Recombinant Protein corresponding to amino acids:HHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG

Species Reactivity



  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20-1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
Positive Controls

Contact Information

Product PDFs

Frequently Purchased Together


Earn rewards points by submitting your review for ACSM1 Antibody (NBP1-91645). Be the first to review this product and earn double rewards points!


Earn rewards if you have published using ACSM1 Antibody (NBP1-91645).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Phospate buffered saline, pH 7.2, containing 40% glycerol
Unit Size
0.1 ml
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
0.02% Sodium Azide
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.


Gene Symbol ACSM1

Alternate Names for ACSM1 Antibody

  • acyl-CoA synthetase medium-chain family member 1EC
  • acyl-coenzyme A synthetase ACSM1, mitochondrial
  • BUCS1
  • Butyrate CoA ligase
  • Butyrate--CoA ligase 1
  • butyryl Coenzyme A synthetase 1
  • Butyryl-coenzyme A synthetase 1
  • EC 6.2.1
  • LAE
  • Lipoate-activating enzyme
  • MACS1MGC150532
  • medium-chain acyl-CoA synthetase
  • Middle-chain acyl-CoA synthetase 1
Show More

Related Products by Gene

Reviews for ACSM1 Antibody (NBP1-91645) (0)

There are no reviews for ACSM1 Antibody (NBP1-91645).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used ACSM1 Antibody (NBP1-91645)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for ACSM1 Antibody (NBP1-91645) (0)

There are no publications for ACSM1 Antibody (NBP1-91645).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using ACSM1 Antibody (NBP1-91645)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for ACSM1 (2)

  1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
    • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
  2. I was wondering what does Format 7C mean as far as anitbodies go?
    • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)

Customers Who Viewed This Item Also Viewed...

Western Blot: ACSM3 Antibody [NBP1-74081] - Titration: 1.0 ug/ml Positive Control: PANC1 Whole Cell.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB

Western Blot: MARCKS Antibody (2C2) [H00004082-M06] - Western Blot analysis of MARCKS expression in Raw 264.7Immunocytochemistry/Immunofluorescence: MARCKS Antibody (2C2) [H00004082-M06] - Immunofluorescence of monoclonal antibody to MARCKS on HeLa cell. [antibody concentration 10 ug/ml]Immunohistochemistry-Paraffin: MARCKS Antibody (2C2) [H00004082-M06] - Immunoperoxidase of monoclonal antibody to MARCKS on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]

Mouse Monoclonal
Species Human, Mouse
Applications WB, ELISA, ICC/IF...MORE

Western Blot: RIN2 Antibody [NBP2-20163] - Sample (30 ug of whole cell lysate) A: HepG2 5% SDS PAGE gel, diluted at 1:1000.Immunocytochemistry/Immunofluorescence: RIN2 Antibody [NBP2-20163] - Confocal immunofluorescence analysis of methanol-fixed HeLa, using RIN2 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments are labeled with Alpha-tubulin antibody (Red) at 1:2000.Immunohistochemistry-Paraffin: RIN2 Antibody [NBP2-20163] - RIN2 antibody detects RIN2 protein at cytosol on hepatoma by immunohistochemical analysis. Sample: Paraffin-embedded U87 xenograft. RIN2 antibody dilution: 1:500.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, ICC/IF, IHC...MORE

Immunohistochemistry-Paraffin: Insulin Antibody (2D11-H5) [NBP2-15195] - Analysisof Insulin in formalin-fixed paraffin embedded human pancreas using Insulin antibody (1:500), peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of cells.

Mouse Monoclonal
Species Human, Porcine, Bovine
Applications WB, ELISA, Flow...MORE

4 Publications
Western Blot: SLC27A3 Antibody [NBP1-89265] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4Immunohistochemistry-Paraffin: SLC27A3 Antibody [NBP1-89265] - Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Rabbit Polyclonal
Species Human
Applications WB, IHC, IHC-P

Western Blot: MYBPH Antibody [NBP1-59131] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB

Western Blot: PPAR gamma Antibody [NBP1-61399] - analysis of PPAR gamma on HeLa cells transfected with vector (left lane) and PPAR gamma overexpression plasmid (right lane) using anti-PPAR gamma antibody. Each lane loaded with 25ug of lysates and an anti-Beta Actin antibody (Cat. # NB600-505) was used as a control. Image from verified customer review.Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP1-61399] - Analysis of paraffin-embedded human placenta tissue, using PPAR gamma  Antibody. The picture on the right is treated with the synthesized peptide.Western Blot: PPAR gamma Antibody [NBP1-61399] - Analysis of extracts from HuvEc cells, using PPAR gamma  Antibody. The lane on the right is treated with the synthesized peptide.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, ELISA, IHC...MORE

     1 Review

2 Publications
Western Blot: CRAT Antibody [NBP1-86616] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG spImmunocytochemistry/Immunofluorescence: CRAT Antibody [NBP1-86616] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli, cytoplasm & golgi apparatus.Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.

Rabbit Polyclonal
Species Human
Applications WB, ICC/IF, IHC...MORE

Western Blot: 67kDa Laminin Receptor Antibody [NBP1-33002] - Sample (30 ug of whole cell lysate) A: Hep G2 12% SDS PAGE; antibody diluted at 1:1000.Immunocytochemistry/Immunofluorescence: 67kDa Laminin Receptor Antibody [NBP1-33002] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.Immunohistochemistry-Paraffin: 67kDa Laminin Receptor Antibody [NBP1-33002] - Paraffin-embedded CA922 xenograft, using antibody at 1:500 dilution.

Rabbit Polyclonal
Species Human, Mouse
Applications WB, ICC/IF, IHC...MORE

1 Publication

Immunocytochemistry/Immunofluorescence: ACSM5 Antibody [NBP1-91646] - Staining of human cell line U-2 OS shows positivity in vesicles.Immunohistochemistry-Paraffin: ACSM5 Antibody [NBP1-91646] - Staining of human kidney shows strong cytoplasmic and extracellular positivity in renal tubules.

Rabbit Polyclonal
Species Human
Applications ICC/IF, IHC, IHC-P

Western Blot: SLC17A5 Antibody [NBP1-59788] - Titration: 0.5ug/ml Positive Control: 293T cells lysate.Immunohistochemistry-Paraffin: SLC17A5 Antibody [NBP1-59788] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

Rabbit Polyclonal
Species Human, Rat, Bovine...MORE
Applications WB, IHC, IHC-P

Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody

Sheep Polyclonal
Species Human
Applications IHC

Western Blot: CPN1 Antibody [NBP1-57960] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml.Immunohistochemistry-Paraffin: CPN1 Antibody [NBP1-57960] - Human Heart Tissue, antibody concentration 2.5 ug/ml.

Rabbit Polyclonal
Species Human, Porcine, Canine...MORE
Applications WB, IHC, IHC-P


Mouse Monoclonal
Species Human
Applications Flow

Western Blot: LYPLA3 Antibody [NBP1-92088] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)<br/>Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92088] - Staining of human kidney shows cytoplasmic and nuclear positivity in tubular cells.Western Blot: LYPLA3 Antibody [NBP1-92088] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue

Rabbit Polyclonal
Species Human
Applications WB, ICC/IF, IHC...MORE

Immunohistochemistry-Paraffin: Progesterone Receptor Antibody (PR-AT 4.14) [NB110-4907] - Both normal and cancer biopsies of deparaffinized Human uterus tissue tissues.

Mouse Monoclonal
Species Human, Mouse, Rat...MORE
Applications WB, ICC/IF, IHC...MORE

Western Blot: ACSL1 Antibody [NB110-99585] - Detection of ACSL in HepG2 whole cell lysates.Immunocytochemistry/Immunofluorescence: ACSL1 Antibody [NB110-99585] - ACSL1 antibody was tested in HepG2 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Simple Western: ACSL1 Antibody [NB110-99585] - Simple Western lane view shows a specific band for ACSL1 in 0.5 mg/ml of HepG2 lysate.  This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB, Simple Western, ICC/IF

1 Publication
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: RT-4<br/>Lane 3: U-251 MG<br/>Lane 4: Human Plasma<br/>Lane 5: Liver<br/>Lane 6: TonsilImmunocytochemistry/Immunofluorescence: Ferredoxin Reductase Antibody [NBP2-38530] - Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.Immunohistochemistry: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human ovary shows strong cytoplasmic positivity in follicle cells.

Rabbit Polyclonal
Species Human
Applications WB, ICC/IF, IHC

Bioinformatics Tool for ACSM1

Discover related pathways, diseases and genes to ACSM1. Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Bioinformatics Tool

Pathways for ACSM1

View related products by pathway.

PTMs for ACSM1

Learn more about PTMs related to ACSM1.

Blogs on ACSM1

There are no specific blogs for ACSM1, but you can read our latest blog posts.