ACSM1 Antibody 0.1 ml

Click image to view larger
Immunocytochemistry/Immunofluorescence: ACSM1 Antibody [NBP1-91645] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: ACSM1 Antibody [NBP1-91645] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Download Datasheet
See All Related

Ordering Information: NBP1-91645

  • Catalog Number
  • Displayed Format
  • Size(s)
    0.1 ml
  • Availability
  • Price

ACSM1 Antibody Summary

Species Human
Tested Applications ICC/IF, IHC, IHC-P
Immunogen affinity purified
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

ACSM1 Antibody Details

This antibody was developed against Recombinant Protein corresponding to amino acids:HHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG

Species Reactivity



  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20-1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
Positive Controls

Contact Information

Product PDFs


Earn rewards points by submitting your review for ACSM1 Antibody (NBP1-91645). Be the first to review this product and earn double rewards points!


Earn rewards if you have published using ACSM1 Antibody (NBP1-91645).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Phospate buffered saline, pH 7.2, containing 40% glycerol
Unit Size
0.1 ml
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
0.02% Sodium Azide
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.


Gene Symbol ACSM1

Alternate Names for ACSM1 Antibody

  • acyl-CoA synthetase medium-chain family member 1EC
  • acyl-coenzyme A synthetase ACSM1, mitochondrial
  • BUCS1
  • Butyrate CoA ligase
  • Butyrate--CoA ligase 1
  • butyryl Coenzyme A synthetase 1
  • Butyryl-coenzyme A synthetase 1
  • EC 6.2.1
  • LAE
  • Lipoate-activating enzyme
  • MACS1MGC150532
  • medium-chain acyl-CoA synthetase
  • Middle-chain acyl-CoA synthetase 1
Show More

Related Products by Gene

Reviews for ACSM1 Antibody (NBP1-91645) (0)

There are no reviews for ACSM1 Antibody (NBP1-91645).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used ACSM1 Antibody (NBP1-91645)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for ACSM1 Antibody (NBP1-91645) (0)

There are no publications for ACSM1 Antibody (NBP1-91645).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using ACSM1 Antibody (NBP1-91645)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for ACSM1 (2)

  1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
    • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
  2. I was wondering what does Format 7C mean as far as anitbodies go?
    • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)

Bioinformatics Tool for ACSM1

Discover related pathways, diseases and genes to ACSM1. Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Bioinformatics Tool

Pathways for ACSM1

View related products by pathway.

PTMs for ACSM1

Learn more about PTMs related to ACSM1.

Blogs on ACSM1

There are no specific blogs for ACSM1, but you can read our latest blog posts.