ACSM1 Antibody 0.1 ml

Click image to view larger
Immunocytochemistry/Immunofluorescence: ACSM1 Antibody [NBP1-91645] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: ACSM1 Antibody [NBP1-91645] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Download Datasheet
See All Related

Ordering Information: NBP1-91645

  • Catalog Number
  • Displayed Format
  • Size(s)
    0.1 ml
  • Availability
  • Price

ACSM1 Antibody Summary

Species Human
Tested Applications ICC/IF, IHC, IHC-P
Immunogen affinity purified
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

ACSM1 Antibody Details

This antibody was developed against Recombinant Protein corresponding to amino acids:HHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
Positive Controls
Control Peptide
ACSM1 Protein (NBP1-91645PEP)

Contact Information

Product PDFs

Frequently Purchased Together


Earn rewards points by submitting your review for ACSM1 Antibody (NBP1-91645). Be the first to review this product and earn double rewards points!


Earn rewards if you have published using ACSM1 Antibody (NBP1-91645).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Phospate buffered saline, pH 7.2, containing 40% glycerol
Unit Size
0.1 ml
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
0.02% Sodium Azide
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.


Gene Symbol ACSM1

Alternate Names for ACSM1 Antibody

  • acyl-CoA synthetase medium-chain family member 1EC
  • acyl-coenzyme A synthetase ACSM1, mitochondrial
  • BUCS1
  • Butyrate CoA ligase
  • Butyrate--CoA ligase 1
  • butyryl Coenzyme A synthetase 1
  • Butyryl-coenzyme A synthetase 1
  • EC 6.2.1
  • LAE
  • Lipoate-activating enzyme
  • MACS1MGC150532
  • medium-chain acyl-CoA synthetase
  • Middle-chain acyl-CoA synthetase 1
Show More

Related Products by Gene

Reviews for ACSM1 Antibody (NBP1-91645) (0)

There are no reviews for ACSM1 Antibody (NBP1-91645).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used ACSM1 Antibody (NBP1-91645)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for ACSM1 Antibody (NBP1-91645) (0)

There are no publications for ACSM1 Antibody (NBP1-91645).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using ACSM1 Antibody (NBP1-91645)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for ACSM1 (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Viewed This Item Also Viewed...

Western Blot: ACSM3 Antibody [H00006296-D01P] - Analysis of ACSM3 expression in mouse kidney.Western Blot: ACSM3 Antibody [H00006296-D01P] - Analysis of ACSM3 expression in transfected 293T cell line by ACSM3 polyclonal antibody.Lane 1: ACSM3 transfected lysate(66.20 KDa).Lane 2: Non-transfected lysate.

Rabbit Polyclonal
Species Human, Mouse
Applications WB, ELISA

Western blot of rat brain lysate showing specific immunolabeling of the ~83 kDa MARCKS protein phosphorylated at S152/S156 (Control). The phosphospecificity of this labeling is demonstrated by treatment with 1200 U of  lambda  Phosphatase ( lambda -PPase) for 30 minutes before being exposed to the Anti-Phospho-MARCKS (S152/S156). The immunolabeling is completely eliminated by treatment with  lambda -PPase.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB

Western Blot: RIN2 Antibody [NBP1-80854] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Immunocytochemistry/Immunofluorescence: RIN2 Antibody [NBP1-80854] - Staining of human cell line U-251 MG shows positivity in cytoplasm & the Golgi apparatus. Antibody staining is shown in green.Immunohistochemistry-Paraffin: RIN2 Antibody [NBP1-80854] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Rabbit Polyclonal
Species Human
Applications WB, ICC/IF, IHC...MORE

2 Publications
Western Blot: SLC27A3 Antibody [NBP1-89265] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Immunohistochemistry-Paraffin: SLC27A3 Antibody [NBP1-89265] - Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Rabbit Polyclonal
Species Human
Applications WB, IHC, IHC-P

Sandwich ELISA: MYBPH Antibody (1F11) [H00004608-M01] - Detection limit for recombinant GST tagged MYBPH is approximately 0.03ng/ml as a capture antibody.

Mouse Monoclonal
Species Human
Applications WB, ELISA, S-ELISA

7 Publications
Western Blot: PPAR gamma/NR1C3 Antibody [NBP1-61399] - Analysis of lysates from HUVEC cells, using PPAR-gamma Antibody. The lane on the right is blocked with the synthesized peptide.Immunohistochemistry-Paraffin: PPAR gamma/NR1C3 Antibody [NBP1-61399] - Analysis of paraffin-embedded human placenta tissue, using PPAR-gamma Antibody. The picture on the right is blocked with the synthesized peptide.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, ELISA, IHC...MORE

     1 Review

2 Publications
Western Blot: CRAT Antibody [NBP1-79532] - HepG2 cell lysate, concentration 0.2-1 ug/ml.Western Blot: CRAT Antibody [NBP1-79532] - Human HepG2, Liver, Testis Antibody Dilution: 2.0 ug/ml.

Rabbit Polyclonal
Species Human
Applications WB

Western Blot: RPSA Antibody [NBP1-33002] -  Sample (30 ug of whole cell lysate) A: Hep G2 12% SDS PAGE; antibody diluted at 1:1000.Immunocytochemistry/Immunofluorescence: RPSA Antibody [NBP1-33002] - paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.Immunohistochemistry-Paraffin: RPSA Antibody [NBP1-33002] - Paraffin-embedded CA922 xenograft, using antibody at 1:500 dilution.

Rabbit Polyclonal
Species Human, Mouse
Applications WB, ICC/IF, IHC...MORE

2 Publications
Immunocytochemistry/Immunofluorescence: ACSM5 Antibody [NBP1-91646] - Staining of human cell line U-2 OS shows positivity in vesicles.Immunohistochemistry-Paraffin: ACSM5 Antibody [NBP1-91646] - Staining of human kidney shows strong cytoplasmic and extracellular positivity in renal tubules.

Rabbit Polyclonal
Species Human
Applications ICC/IF, IHC, IHC-P

Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.Immunohistochemistry-Paraffin: SLC17A5 Antibody [NBP2-20383] - Immunohistochemical analysis of paraffin-embedded BT474 xenograft, using antibody at 1:500 dilution.

Rabbit Polyclonal
Species Human
Applications WB, ICC/IF, IHC...MORE

Western Blot: CPN1 Antibody [NBP1-57960] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml.Immunohistochemistry-Paraffin: CPN1 Antibody [NBP1-57960] - Human Heart Tissue, antibody concentration 2.5 ug/ml.

Rabbit Polyclonal
Species Human
Applications WB, IHC, IHC-P

WS‑1 human fetal skin fibroblast cell line was stained with Mouse Anti-Human FATP4 APC‑conjugated Monoclonal Antibody (Catalog # FAB3650A, filled histogram) or isotype control antibody (Catalog # IC0041A, open histogram). View our protocol for Staining Membrane-associated Proteins.

Mouse Monoclonal
Species Human
Applications Flow

Western Blot: LYPLA3 Antibody [NBP1-92088] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92088] - Staining of human kidney shows cytoplasmic and nuclear positivity in tubular cells.Western Blot: LYPLA3 Antibody [NBP1-92088] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

Rabbit Polyclonal
Species Human
Applications WB, ICC/IF, IHC...MORE

Immunohistochemistry-Paraffin: Progesterone R/NR3C3 Antibody (Alpha PR6) [NB120-2765] - Staining of human uterus tissue.

Mouse Monoclonal
Species Human, Mouse, Rat...MORE
Applications WB, ICC/IF, IHC...MORE

Western Blot: ACSL1 Antibody [NB110-99585] - Detection of ACSL in HepG2 whole cell lysates.Immunocytochemistry/Immunofluorescence: ACSL1 Antibody [NB110-99585] - ACSL1 antibody was tested in HepG2 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).Simple Western: ACSL1 Antibody [NB110-99585] - Simple Western lane view shows a specific band for ACSL1 in 0.5 mg/ml of HepG2 lysate.  This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB, Simple Western, ICC/IF

1 Publication
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: RT-4Lane 3: U-251 MGLane 4: Human PlasmaLane 5: LiverLane 6: TonsilImmunocytochemistry/Immunofluorescence: Ferredoxin Reductase Antibody [NBP2-38530] - Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.Immunohistochemistry: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human ovary shows strong cytoplasmic positivity in follicle cells.

Rabbit Polyclonal
Species Human
Applications WB, ICC/IF, IHC...MORE

Bioinformatics Tool for ACSM1

Discover related pathways, diseases and genes to ACSM1. Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Bioinformatics Tool
Vizit™, under license from BioVista Inc.

Pathways for ACSM1

View related products by pathway.

PTMs for ACSM1

Learn more about PTMs related to ACSM1.

Blogs on ACSM1

There are no specific blogs for ACSM1, but you can read our latest blog posts.