Home » LMW-PTP/ACP1 » ACP1 Peptides and Proteins » Recombinant Human LMW-PTP/ACP1 Protein

We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Register on R&D Systems

Recombinant Human LMW-PTP/ACP1 Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related LMW-PTP/ACP1 Peptides and Proteins

Order Details


    • Catalog Number
      H00000052-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human LMW-PTP/ACP1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-158 of Human ACP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Protein/Peptide Type
Recombinant Protein
Gene
ACP1

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LMW-PTP/ACP1 Protein

  • acid phosphatase 1, soluble
  • acid phosphatase of erythrocyte
  • ACP1
  • Adipocyte acid phosphatase
  • cytoplasmic phosphotyrosyl protein phosphatase
  • EC 3.1.3.2
  • EC 3.1.3.48
  • HAAP
  • LMWPTP
  • LMW-PTP
  • LMW-PTPase
  • Low molecular weight cytosolic acid phosphatase
  • low molecular weight phosphotyrosine protein phosphatase
  • MGC111030
  • MGC3499
  • protein tyrosine phosphatase
  • Red cell acid phosphatase 1

Background

ACP1( AAH07422, 1 a.a. - 159 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PGM1 Antibody
(3B8-H4) - Azide and ...
H00005236-M01
Western Blot PGM1 Antibody (3B8-H4) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence PGM1 Antibody (3B8-H4) - Azide and BSA Free
Immunoprecipitation PGM1 Antibody (3B8-H4) - Azide and BSA Free
(2 Publications)
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
ESD Antibody - BSA
Free
NBP2-16374
Immunohistochemistry-Paraffin ESD Antibody - BSA Free
Western Blot ESD Antibody - BSA Free
Western Blot ESD Antibody - BSA Free
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
Adenosine
Deaminase/ADA Antibod ...
NBP1-87404
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody - BSA Free
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Adenosine Deaminase/ADA Antibody - BSA Free
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
Haptoglobin [HRP]
DHAPG0
N/A Haptoglobin [HRP]
N/A Haptoglobin [HRP]
(7 Publications)
Species: Hu
Applications: ELISA
Glyoxalase I
Antibody (Glo1a) - BS ...
NBP1-19015
Simple Western Glyoxalase I Antibody (Glo1a) - BSA Free
Western Blot Glyoxalase I Antibody (Glo1a) - BSA Free
Immunocytochemistry/ Immunofluorescence Glyoxalase I Antibody (Glo1a) - BSA Free
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF,  IHC-P, IP, Simple Western, WB
DLC1 Antibody -
Isoform 1 and 3
NB300-917
Immunofluorescence DLC1 Antibody - Isoform 1 and 3
Immunofluorescence DLC1 Antibody - Isoform 1 and 3
Immunohistochemistry-Paraffin DLC1 Antibody - Isoform 1 and 3
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
PGD Antibody - BSA
Free
NBP1-31589
Western Blot PGD Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PGD Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PGD Antibody - BSA Free
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
Lewis A Blood
Group Antigen Antibod ...
NB500-525
Immunohistochemistry Lewis A Blood Group Antigen Antibody (7LE) - BSA Free
Immunohistochemistry-Paraffin Lewis A Blood Group Antigen Antibody (7LE) - BSA Free
Immunohistochemistry-Paraffin Lewis A Blood Group Antigen Antibody (7LE) - BSA Free
(2 Publications)
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
Holo-Transferrin
[Unconjugated]
2914-HT
Holo-Transferrin [Unconjugated]
(56 Publications)
Species: Hu
Applications: BA
Coagulation Factor
III/Tissue Factor [HR ...
DCF300
N/A Coagulation Factor III/Tissue Factor [HRP]
N/A Coagulation Factor III/Tissue Factor [HRP]
(30 Publications)
Species: Hu
Applications: ELISA
Adenylate Kinase 1
Antibody - BSA Free
NBP1-87401
Immunocytochemistry/ Immunofluorescence Adenylate Kinase 1 Antibody - BSA Free
Immunohistochemistry-Paraffin Adenylate Kinase 1 Antibody - BSA Free
Immunohistochemistry-Paraffin Adenylate Kinase 1 Antibody - BSA Free
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
PHGDH Antibody -
BSA Free
NBP1-87311
Western Blot PHGDH Antibody - BSA Free
Western Blot PHGDH Antibody - BSA Free
Simple Western PHGDH Antibody - BSA Free
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(37 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
GPT Antibody - BSA
Free
NBP1-89111
Western Blot GPT Antibody - BSA Free
Immunohistochemistry-Paraffin GPT Antibody - BSA Free
Immunohistochemistry-Paraffin GPT Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
Glycophorin A
Antibody (R10) [Uncon ...
MAB1228
Immunohistochemistry Glycophorin A Antibody (R10) [Unconjugated]
Flow Cytometry Glycophorin A Antibody (R10) [Unconjugated]
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
RHCE Antibody -
BSA Free
NBP3-17923
Immunohistochemistry-Paraffin RHCE Antibody - BSA Free
Species: Hu
Applications: IHC,  IHC-P
RHD Antibody - BSA
Free
NBP2-84247
Western Blot RHD Antibody - BSA Free
Western Blot RHD Antibody - BSA Free
Western Blot RHD Antibody - BSA Free
Species: Hu
Applications: WB
DPAGT1 Antibody -
BSA Free
NBP2-81923
Western Blot DPAGT1 Antibody - BSA Free
Immunohistochemistry DPAGT1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence DPAGT1 Antibody - BSA Free
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
ACP2 Antibody
(M1-4A12) - Azide and ...
H00000053-M01
Western Blot ACP2 Antibody (M1-4A12) - Azide and BSA Free
ELISA ACP2 Antibody (M1-4A12) - Azide and BSA Free
Western Blot ACP2 Antibody (M1-4A12) - Azide and BSA Free
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB

Publications for LMW-PTP/ACP1 Recombinant Protein (H00000052-P01) (0)

There are no publications for LMW-PTP/ACP1 Recombinant Protein (H00000052-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMW-PTP/ACP1 Recombinant Protein (H00000052-P01) (0)

There are no reviews for LMW-PTP/ACP1 Recombinant Protein (H00000052-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LMW-PTP/ACP1 Recombinant Protein (H00000052-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LMW-PTP/ACP1 Products

Research Areas for LMW-PTP/ACP1 Recombinant Protein (H00000052-P01)

Find related products by research area.

Blogs on LMW-PTP/ACP1

There are no specific blogs for LMW-PTP/ACP1, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LMW-PTP/ACP1 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol ACP1