ACD Antibody (H00065057-M01A)
ACD Antibody (1C11-1A7)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-24432 antibody, anti-TINT1 antibody, anti-PTOP antibody, anti-Pip1 antibody, |
|
|
ACD Antibody (1C11-1A7) Summary: | | Gene: | ACD |
|---|
| Purity: | Ascites |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ACD - adrenocortical dysplasia homolog (mouse) (1C11-1A7) |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ACD Products ACD Antibody (1C11-1A7) Details: | Clone: | 1C11-1A7 |
|---|
| Isotype: | IgG1 Kappa |
|---|
| Immunogen: | ACD (AAH16904, 1 a.a. ~ 545 a.a) full-length recombinant protein with GST tag. |
|---|
| Epitope: | MPGRCQSDAAMRVNGPASRAPAGWTSGSLH TGPRAGRPRAQARGVRGRGLLLRPRPAKEL PLPRKGGAWAPAGNPGPLHPLGVAVGMAGS GRLVLRPWIRELILGSETPSSPRAGQLLEV LQDAEAAVAGPSHAPDTSDVGATLLVSDGT HSVRCLVTREALDTSDWEEKEFGFRGTEGR LLLLQDCGVHVQVAEGGAPAEFYLQVDRFS LLPTEQPRLRVPGCNQDLDVQKKLYDCLEE HLSESTSSNAGLSLS |
|---|
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.2 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In ascites fluid |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other components, this protein plays a key role in the assembly and stabilization of this complex, and it mediates the access of telomerase to the telomere. Multiple transcript variants encoding different isoforms have been found for this gene. This gene, which is also referred to as TPP1, is distinct from the unrelated TPP1 gene on chromosome 11, which encodes tripeptidyl-peptidase I.
|
Reviews (0) Related Products (17)
|
Jump to: Ask a Question
|
Working with ACD
ACD Antibody (1C11-1A7) Images (0)
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ACD? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (4)Peptides and ProteinsPrimary Antibodies (8)RNAi (3)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
