ACAT2 Antibody (H00000039-D01P)
ACAT2 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
|
|
ACAT2 Antibody Summary: | | Gene: | ACAT2 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Rabbit |
|---|
| | Specificity: | ACAT2 - acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase), |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ACAT2 Products ACAT2 Antibody Details: | Immunogen: | ACAT2 (AAH00408.1, 1 a.a. ~ 397 a.a) full-length human protein. |
|---|
| Epitope: | MNAGSDPVVIVSAARTIIGSFNGALAAVPV QDLGSTVIKEVLKRATVAPEDVSEVIFGHV LAAGCGQNPVRQASVGAGIPYSVPAWSCQM ICGSGLKAVCLAVQSIGIGDSSIVVAGGME NMSKAPHLAYLRTGVKIGEMPLTDSILCDG LTDAFHNCHMGITAENVAKKWQVSREDQDK VAVLSQNRTENAQKAGHFDKEIVPVLVSTR RGLIEVKTDEFPRHGSNIEAMSKLKPYFLT DGTGTVTPANASGIN |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The product of this gene is an enzyme involved in lipid metabolism, and it encodes cytosolic acetoacetyl-CoA thiolase. This gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation. [provided by RefSeq]
|
Images (2) Reviews (0) Related Products (22) Exploring ACAT2
|
Jump to: Images, Ask a Question
|
Working with ACAT2
ACAT2 Antibody Images (2) Western Blot analysis of ACAT2 expression in transfected 293T cell line by ACAT2 MaxPab rabbit polyclonal antibody.
Lane 1: ACAT2 transfected lysate(41.40 KDa).
Lane 2: Non-transfected lysate.
|  ACAT2 MaxPab rabbit polyclonal antibody. Western Blot analysis of ACAT2 expression in human liver. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ACAT2? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (2)Lysates (3)Peptides and ProteinsPrimary Antibodies (12)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Rabbit IgG Antibody [HRP] | NB730-H | Rb | ELISA, ICC, IHC-P, WB | | (5) | | | | Rabbit IgG Antibody [FITC] | NB730-F | Rb | ICC, IHC-P | | (1) | | | | Rabbit IgG Antibody [Biotin] | NB730-B | Rb | ELISA, ICC, IHC-P, WB | | | | | | Rabbit IgG, H/L Chains Antibody [DyLight 488] | NBP1-72944 | Rb | FLISA, IF, WB | (3) | | | | | Rabbit IgG Antibody [Alkaline Phosphatase] | NB730-AP | Rb | ELISA, ICC, IHC-P, WB | | (1) | | | | See All » |
|
|
