ACAT2 Antibody (H00000039-A01)
ACAT2 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
|
|
ACAT2 Antibody Summary: | | Gene: | ACAT2 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ACAT2 - acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase) |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ACAT2 Products ACAT2 Antibody Details: | Immunogen: | ACAT2 (NP_005882, 104 a.a. ~ 214 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | QSIGIGDSSIVVAGGMENMSKAPHLAYLRT GVKIGEMPLTDSILCDGLTDAFHNCHMGIT AENVATKWQVSREDQDKVAVLSQNRTENAQ KAGHFDKEIVPVLVSTRKGL* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The product of this gene is an enzyme involved in lipid metabolism, and it encodes cytosolic acetoacetyl-CoA thiolase. This gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.
|
Images (1) Reviews (0) Related Products (22) Exploring ACAT2
|
Jump to: Images, Ask a Question
|
Working with ACAT2
ACAT2 Antibody Images (1) ACAT2 polyclonal antibody (A01), Lot # 060509JCS1 Western Blot analysis of ACAT2 expression in Jurkat ( Cat # L017V1 ). |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ACAT2? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (2)Lysates (3)Peptides and ProteinsPrimary Antibodies (13)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
