ABT1 Antibody (H00029777-B02)
ABT1 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-hABT1 antibody, |
|
|
ABT1 Antibody Summary: | | Gene: | ABT1 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ABT1 - activator of basal transcription 1, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ABT1 Products ABT1 Antibody Details: | Immunogen: | ABT1 (-, 1 a.a. ~ 272 a.a) full-length human protein. |
|---|
| Epitope: | MEAEESEKAATEQEPLEGTEQTLDAEEEQE ESEEAACGSKKRVVPGIVYLGHIPPRFRPL HVRNLLSAYGEVGRVFFQAEDRFVRRKKKA AAAAGGKKRSYTKDYTEGWVEFRDKRIAKR VAASLHNTPMGARRRSPFRYDLWNLKYLHR FTWSHLSEHLAFERQVRRQRLRAEVAQAKR ETDFYLQSVERGQRFLAADGDPARPDGSWT FAQRPTEQELRARKAARPGGRERARLATAQ DKARSNKGLLARIFG |
|---|
| Uses: | Antibody reactive against transfected lysate for Western Blot. Has also been used for immunofluoresence and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Western Blot 1:500, |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This is unpurified antiserum so it is not possible to supply the specific antibody concentration. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Basal transcription of genes by RNA polymerase II requires the interaction of TATA-binding protein (TBP) with the core region of class II promoters. Studies in mouse suggest that the protein encoded by this gene likely activates basal transcription from class II promoters by interaction with TBP and the class II promoter DNA.
|
Images (2) Reviews (0) Related Products (9)
|
Jump to: Images, Ask a Question
|
Working with ABT1
ABT1 Antibody Images (2) Immunofluorescence of purified MaxPab antibody to ABT1 ( Cat# H00029777-B02 ) on HeLa cell . [antibody concentration 10 ug/ml] |  Western Blot analysis of ABT1 expression in transfected 293T cell line by ABT1 MaxPab polyclonal antibody (B02).
Lane 1: ABT1 transfected lysate(31.10 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ABT1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (4)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
