We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ABCG2/CD338 Antibody

Images

 

Product Details

Summary
Product Discontinued
View other related ABCG2/CD338 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59749
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ABCG2/CD338 Antibody Summary

Immunogen
Synthetic peptides corresponding to ABCG2(ATP-binding cassette, sub-family G (WHITE), member 2) The peptide sequence was selected from the N terminal of ABCG2 (NP_004818). Peptide sequence SGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDP.
Marker
Stem Cell Marker
Clonality
Polyclonal
Host
Rabbit
Gene
ABCG2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Simple Western 1:50
  • Western Blot 1:100-1:2000
Application Notes
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 27840292).
Theoretical MW
72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-59749 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
From PBS & 2% Sucrose.
Preservative
No Preservative
Purity
IgG purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ABCG2/CD338 Antibody

  • ABC transporter
  • ABC15
  • ABCG2
  • ABCP
  • ABCPMGC102821
  • ATP-binding cassette sub-family G member 2
  • ATP-binding cassette transporter G2
  • ATP-binding cassette, sub-family G (WHITE), member 2
  • BCRP
  • BCRP1
  • BCRPMRX
  • BMDP
  • Breast cancer resistance protein
  • CD338 antigen
  • CD338
  • CDw338
  • EST157481
  • mitoxantrone resistance protein
  • Mitoxantrone resistance-associated protein
  • MXR
  • MXRMXR1
  • placenta specific MDR protein
  • Placenta-specific ATP-binding cassette transporter

Background

ABCG2 is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue.The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
NBP1-69023
Species: Mu
Applications: WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-24587
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-556
Species: Hu
Applications: IP, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-76670
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-82820
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-46186
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA, WB
AF6278
Species: Hu, Mu
Applications: WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MAB4077
Species: Hu
Applications: IHC, WB
NB100-74482
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-59749
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC

Publications for ABCG2/CD338 Antibody (NBP1-59749)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(2)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ABCG2/CD338 Antibody (NBP1-59749) (0)

There are no reviews for ABCG2/CD338 Antibody (NBP1-59749). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ABCG2/CD338 Antibody (NBP1-59749) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCG2/CD338 Products

Research Areas for ABCG2/CD338 Antibody (NBP1-59749)

Find related products by research area.

Blogs on ABCG2/CD338

There are no specific blogs for ABCG2/CD338, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCG2/CD338 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCG2
Entrez
Uniprot