ABCG2 Antibody (H00009429-D01P)

ABCG2 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
ABCG2 Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:ABCG2
Purity:Protein A purified
Host:Rabbit
Specificity:ABCG2 - ATP-binding cassette, sub-family G (WHITE), member 2,
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional ABCG2 Products
ABCG2 Antibody Details:
Immunogen:ABCG2 (AAH21281.1, 1 a.a. ~ 655 a.a) full-length human protein.
Marker:Hematopoietic Stem Cell Marker
Epitope:MSSSNVEVFIPVSQGNTNGFPATASNDLKA FTEGAVLSFHNICYRVKLKSGFLPCRKPVE KEILSNINGIMKPGLNAILGPTGGGKSSLL DVLAARKDPSGLSGDVLINGAPRPANFKCN SGYVVQDDVVMGTLTVRENLQFSAALRLAT TMTNHEKNERINRVIQELGLDKVADSKVGT QFIRGVSGGERKRTSIGMELITDPSILFLD EPTTGLDSSTANAVLLLLKRMSKQGRTIIF SIHQPRYSIFKLFDS
Species Reactivity:

Human.

Applications:
Uses:Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: ABCG2
Entrez9429 (Human)
Swiss ProtAAH21281.1 (Human)
 
Background:

The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue. [provided by RefSeq]

Jump to: Images, Ask a Question

Working with ABCG2

ABCG2 Antibody Images (1)
Western Blot analysis of ABCG2 expression in transfected 293T cell line by ABCG2 MaxPab rabbit polyclonal antibody.

Lane 1: ABCG2 transfected lysate(72.30 KDa).
Lane 2: Non-transfected lysate.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about ABCG2? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCG2 LysateH00009429-T01HuWB(2)

ABCG2 LysateNBL1-07187WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCG2 Partial Recombinant ProteinH00009429-Q01HuELISA, WB(1)

ABCG2 Partial Recombinant ProteinH00009429-Q02HuELISA, WB(1)

ABCG2 Recombinant ProteinH00009429-P01HuELISA, WB(1)

ABCG2 ProteinH00009429-G01HuFunc

Primary Antibodies (18)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCG2 Antibody (BXP-9)NB600-1079MuFACS, ICC, IHC-Fr, IHC-P, WB

ABCG2 Antibody (BXP-21)NB100-2177HuICC, IHC-Fr, IHC-P, WB(1)

ABCG2 AntibodyNBP1-59749Hu, Mu, RtIHC-P, WB(1)

ABCG2 AntibodyNBP1-19758HuIHC-P, WB(2)

ABCG2 AntibodyH00009429-B01PHuELISA, FACS, WB(2)

... and 13 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCG2 RNAiH00009429-R02Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Rabbit IgG Antibody [HRP]NB730-HRbELISA, ICC, IHC-P, WB(5)

Rabbit IgG Antibody [FITC]NB730-FRbICC, IHC-P(1)

Rabbit IgG Antibody [Biotin]NB730-BRbELISA, ICC, IHC-P, WB

Rabbit IgG, H/L Chains Antibody [DyLight 488]NBP1-72944RbFLISA, IF, WB(3)

Rabbit IgG Antibody [Alkaline Phosphatase]NB730-APRbELISA, ICC, IHC-P, WB(1)

See All »

Jump to: Novus Explorer, Research Areas

ABCG2 in Context


Research Areas related to ABCG2 (6):
Novus Explorer for ABCG2 gene

Try our bioinformatic tool that shows the relationships between ABCG2 and other genes, diseases, pathways and post-translational modifications.