ABCG2 Antibody (H00009429-B01P)
ABCG2 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ABC15 antibody, Anti-MXR1 antibody, anti-MXR antibody, anti-MRX antibody, anti-MGC102821 antibody, Anti-EST157481 antibody, anti-BMDP antibody, anti-BCRP1 antibody, anti-BCRP antibody, anti-ABCP antibody |
|
|
ABCG2 Antibody Summary: | | Gene: | ABCG2 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ABCG2 - ATP-binding cassette, sub-family G (WHITE), member 2, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ABCG2 Products ABCG2 Antibody Details: | Immunogen: | ABCG2 (AAH21281.1, 1 a.a. ~ 655 a.a) full-length human protein. |
|---|
| Marker: | Hematopoietic Stem Cell Marker |
|---|
| Epitope: | MSSSNVEVFIPVSQGNTNGFPATASNDLKA FTEGAVLSFHNICYRVKLKSGFLPCRKPVE KEILSNINGIMKPGLNAILGPTGGGKSSLL DVLAARKDPSGLSGDVLINGAPRPANFKCN SGYVVQDDVVMGTLTVRENLQFSAALRLAT TMTNHEKNERINRVIQELGLDKVADSKVGT QFIRGVSGGERKRTSIGMELITDPSILFLD EPTTGLDSSTANAVLLLLKRMSKQGRTIIF SIHQPRYSIFKLFDS |
|---|
| Uses: | Antibody reactive against transfected lysate for western blot. It has also been used for ELISA and FACS analysis. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA,
Flow Cytometry |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue. [provided by RefSeq]
|
Images (2) Reviews (0) Related Products (31) Exploring ABCG2
|
Jump to: Images, Ask a Question
|
Working with ABCG2
ABCG2 Antibody Images (2) Western Blot analysis of ABCG2 expression in transfected 293T cell line by ABCG2 purified MaxPab polyclonal antibody (B01P).
Lane 1: ABCG2 transfected lysate(72.30 KDa).
Lane 2: Non-transfected lysate.
|  FACS analysis of negative control 293 cells (Black) and ABCG2 expressing 293 cells (Green) using ABCG2 purified MaxPab mouse polyclonal antibody. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ABCG2? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (18)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| ABCG2 Antibody (BXP-9) | NB600-1079 | Mu | FACS, ICC, IHC-Fr, IHC-P, WB | | | | | | ABCG2 Antibody (BXP-21) | NB100-2177 | Hu | ICC, IHC-Fr, IHC-P, WB | | (1) | | | | ABCG2 Antibody | NBP1-59749 | Hu, Mu, Rt | IHC-P, WB | (1) | | | | | ABCG2 Antibody | NBP1-19758 | Hu | IHC-P, WB | (2) | | | | | ABCG2 Antibody (BXP-53) | NBP1-51711 | Mu | FACS, IHC-Fr, WB | | | | | | ... and 13 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
