Home » Products » Primary Antibodies » ABCG2 Antibody (H00009429-A01) (0.05 ml)
 

ABCG2 Antibody (H00009429-A01)

ABCG2 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 ml
 
Bulk Request
(see alternate names)
ABCG2 Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:ABCG2
Purity:Whole antisera
Host:Mouse
Specificity:ABCG2 - ATP-binding cassette, sub-family G (WHITE), member 2
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional ABCG2 Products
LysatesPeptides and Proteins
Primary AntibodiesRNAi
 
» View all ABCG2 Related Products
ABCG2 Antibody Details:
Immunogen:ABCG2 (NP_004818, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
Marker:Hematopoietic Stem Cell Marker
Epitope:MSSSNVEVFIPVSQGNTNGFPATVSNDLKA FTEGAVLSFHNICYRVKLKSGFLPCRKPVE KEILSNINGIMKPGLNAILGPTGGGKSSLL DVLAARKDPSGLSGDVLING*
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Dilutions:ELISA, Western Blot 1:500
Unit Size:0.05 ml
Concentration:This product is unpurified. Concentration is not relevant.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol.
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: ABCG2
Entrez9429 (Human)
OMIM603756 (Human)
Swiss ProtNP_004818 (Human)
 
Background:

The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue.
Images (1)
  • ABCG2 polyclonal antibody (A01), Lot # 051017JC01. Western Blot analysis of ABCG2 expression in Raw 264.7.

See all images...

Reviews (0)

Be the first to review this product for a reward!

Related Products (31)

2 Lysates

4 Peptides and Proteins

18 Primary Antibodies

1 RNAi

Secondary Antibodies

Exploring ABCG2

6 Related Research Areas
Jump to: Images, Ask a Question

Working with ABCG2

ABCG2 Antibody Images (1)
ABCG2 polyclonal antibody (A01), Lot # 051017JC01. Western Blot analysis of ABCG2 expression in Raw 264.7.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.
Protocols
All General Protocols

Ask a Scientist

Can't find an answer to your question about ABCG2? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCG2 LysateH00009429-T01HuWB(2)

ABCG2 LysateNBL1-07187WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCG2 Partial Recombinant ProteinH00009429-Q01HuELISA, WB(1)

ABCG2 Partial Recombinant ProteinH00009429-Q02HuELISA, WB(1)

ABCG2 Recombinant ProteinH00009429-P01HuELISA, WB(1)

ABCG2 ProteinH00009429-G01HuFunc

Primary Antibodies (18)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCG2 Antibody (BXP-9)NB600-1079MuFACS, ICC, IHC-Fr, IHC-P, WB

ABCG2 Antibody (BXP-21)NB100-2177HuICC, IHC-Fr, IHC-P, WB(1)

ABCG2 AntibodyNBP1-59749Hu, Mu, RtIHC-P, WB(1)

ABCG2 AntibodyNBP1-19758HuIHC-P, WB(2)

ABCG2 AntibodyH00009429-B01PHuELISA, FACS, WB(2)

... and 13 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCG2 RNAiH00009429-R02Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »
Jump to: Novus Explorer, Research Areas

ABCG2 in Context

Research Areas related to ABCG2 (6):
Novus Explorer for ABCG2 gene
Try our bioinformatic tool that shows the relationships between ABCG2 and other genes, diseases, pathways and post-translational modifications.