ABCG1 Antibody (H00009619-M03)

ABCG1 Antibody (2H8)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
ABCG1 Antibody (2H8) Summary:
Species:Hu
Applications:ELISA
Clonality:Monoclonal
Gene:ABCG1
Purity:IgG purified
Host:Mouse
Specificity:ABCG1 - ATP-binding cassette, sub-family G (WHITE), member 1 (2H8)
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional ABCG1 Products
ABCG1 Antibody (2H8) Details:
Clone:2H8
Isotype:IgG1
Immunogen:ABCG1 (AAH29158, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Epitope:AEMTEPKSVCVSVDEVVSSNMEATETDLLN GHLKKVDNNLTEAQRFSSLPRRAAVNIEFR DLSYSVPEGPWWRKKGYKTLLKGISGKFNS GELVAIMGPSGAGKSTLMNI
Species Reactivity:

Human.

Applications:
Uses:This product is useful for ELISA.
Dilutions:ELISA
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: ABCG1
Entrez9619 (Human)
Swiss ProtAAH29158 (Human)
 
Background:

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified. [provided by RefSeq]

Jump to: Ask a Question

Working with ABCG1

ABCG1 Antibody (2H8) Images (0)
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about ABCG1? Ask us by using live chat or by submitting your questions below:

 
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCG1 PeptideNB400-132PEP

ABCG1 Partial Recombinant ProteinH00009619-Q01HuELISA, WB(1)

ABCG1 Recombinant ProteinH00009619-P01HuELISA, WB(1)

Primary Antibodies (10)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCG1 AntibodyNB400-132Hu, MuICC, IF, IHC-P, WB(2)(29)

ABCG1 Antibody (EP1366Y)NB110-55438Hu, Mu, RtICC, IHC-P, WB(2)(4)

ABCG1 Antibody (2E11)H00009619-M01HuELISA(1)

ABCG1 Antibody [DyLight 650]NB400-132CHu, MuIHC, WB(22)

ABCG1 Antibody [DyLight 488]NB400-132GHu, MuIHC, WB(22)

... and 5 more. See All »
RNAi (7)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCG1 RNAiH00009619-R08Hu(1)(4)

ABCG1 RNAiH00009619-R11Hu(1)(4)

ABCG1 RNAiH00009619-R14Hu(1)(4)

ABCG1 RNAiH00009619-R12Hu(1)(4)

ABCG1 RNAiH00009619-R13Hu(1)(4)

... and 2 more. See All »
Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

ABCG1 in Context


Research Areas related to ABCG1 (1):
Novus Explorer for ABCG1 gene

Try our bioinformatic tool that shows the relationships between ABCG1 and other genes, diseases, pathways and post-translational modifications.