ABCG1 Antibody (H00009619-M01)
ABCG1 Antibody (2E11)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ABC8 antibody, anti-WHITE1 antibody, anti-MGC34313 antibody, |
|
|
ABCG1 Antibody (2E11) Summary: | | Gene: | ABCG1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ABCG1 Products ABCG1 Antibody (2E11) Details: | Clone: | 2E11 |
|---|
| Isotype: | IgG1 Lambda |
|---|
| Immunogen: | Partial recombinant human protein with GST tag, between amino acids 21-130 [NCBI#AAH29158]. |
|---|
| Epitope: | AEMTEPKSVCVSVDEVVSSNMEATETDLLN GHLKKVDNNLTEAQRFSSLPRRAAVNIEFR DLSYSVPEGPWWRKKGYKTLLKGISGKFNS GELVAIMGPSGAGKSTLMNI |
|---|
Human. Other species have not been tested. |
| Uses: | Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control. |
|---|
| Dilutions: | ELISA |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | PBS, [pH7.2] |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified.
|
Images (1) Reviews (0) Related Products (21) Exploring ABCG1
|
Jump to: Images, Ask a Question
|
Working with ABCG1
ABCG1 Antibody (2E11) Images (1) Detection limit for recombinant GST tagged ABCG1 is approximately 0.1ng/ml as a capture antibody. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ABCG1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsPeptides and ProteinsPrimary Antibodies (10)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| ABCG1 Antibody | NB400-132 | Hu, Mu | ICC, IF, IHC-P, WB | (2) | (29) | | | | ABCG1 Antibody (EP1366Y) | NB110-55438 | Hu, Mu, Rt | ICC, IHC-P, WB | (2) | (4) | | | | ABCG1 Antibody (2H8) | H00009619-M03 | Hu | ELISA | | | | | | ABCG1 Antibody [DyLight 488] | NB400-132G | Hu, Mu | IHC, WB | | (22) | | | | ABCG1 Antibody [DyLight 550] | NB400-132R | Hu, Mu | IHC, WB | | (22) | | | | ... and 5 more. See All » |
RNAi (7)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
