ABCD1 Antibody (H00000215-M01)

ABCD1 Antibody (4B5)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
ABCD1 Antibody (4B5) Summary:
Species:Hu
Applications:ELISA
Clonality:Monoclonal
Gene:ABCD1
Purity:IgG purified
Host:Mouse
Specificity:ABCD1 - ATP-binding cassette, sub-family D (ALD), member 1
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional ABCD1 Products
ABCD1 Antibody (4B5) Details:
Clone:4B5
Isotype:IgG2a Kappa
Immunogen:ABCD1 (AAH15541, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Epitope:MPVLSRPRPWRGNTLKRTAVLLALAAYGAH KVYPLVRQCLAPARGLQAPAGEPTQEASGV AAAKAGMNRVFLQRLLWLLRLLFPRVLCRE TGLLALHSAA*
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against recombinant protein on ELISA.
Dilutions:ELISA
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: ABCD1
Entrez215 (Human)
OMIM300100, 300371,
Swiss ProtAAH15541 (Human)
 
Background:

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein is likely involved in the peroxisomal transport or catabolism of very long chain fatty acids. Defects in this gene have been identified as the underlying cause of adrenoleukodystrophy, an X-chromosome recessively inherited demyelinating disorder of the nervous system.

Jump to: Ask a Question

Working with ABCD1

ABCD1 Antibody (4B5) Images (0)
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about ABCD1? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCD1 LysateNBL1-07179WB(1)

ABCD1 LysateH00000215-T01WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCD1 Partial Recombinant ProteinH00000215-Q01HuELISA, WB(1)

ABCD1 Recombinant ProteinH00000215-P01HuELISA, WB(1)

Primary Antibodies (8)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCD1 Antibody (EP1363Y)NBP1-44394Hu, Mu, RtIHC-P, WB

ABCD1 AntibodyNB100-96913HuPEP-ELISA(1)(1)

ABCD1 AntibodyNBP1-68397HuELISA, WB(1)

ABCD1 AntibodyNBP1-00700HuELISA, WB(1)

ABCD1 AntibodyPAB7486HuELISA, WB

... and 3 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCD1 RNAiH00000215-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer

ABCD1 in Context


Novus Explorer for ABCD1 gene

Try our bioinformatic tool that shows the relationships between ABCD1 and other genes, diseases, pathways and post-translational modifications.