ABCA7 Antibody

Name: ABCA7 Antibody
Brand: Novus Biologicals
SKU: NBP1-69064
Price: 329 USD
Availability: Discontinued

Submit a Review

Images

Product Details

Summary

Product Discontinued

Order Details

Catalog Number

NBP1-69064
Availability

Product Discontinued

Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

Or feel free to contact us for alternative products.

ABCA7 Antibody Summary

Immunogen	Synthetic peptides corresponding to Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7) The peptide sequence was selected from the middle region of Abca7. Peptide sequence DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL.
Predicted Species	Human (100%), Rat (100%), Canine (100%), Guinea Pig (100%), Bovine (93%). Backed by our 100% Guarantee.
Clonality	Polyclonal
Host	Rabbit
Gene	ABCA7
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	Western Blot 1:100-1:2000
Application Notes	This is a rabbit polyclonal antibody against Abca7 and was validated on Western blot.
Theoretical MW	237 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 2% Sucrose
Preservative	0.09% Sodium Azide
Concentration	LYOPH
Purity	Immunogen affinity purified
Reconstitution Instructions	Reconstitute with sterile H2O.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ABCA7 Antibody

ABCA-SSN
ABCXATP-binding cassette sub-family A member 7
ATP-binding cassette, sub-family A (ABC1), member 7
Autoantigen SS-N
EC 2.2.1.1
EC 3.6.3
EC 3.6.3.41
FLJ40025
Macrophage ABC transporter

Background

Abca7 plays a role in phagocytosis by macrophages of apoptotic cells.Abca7 binds APOA1 and may function in apolipoprotein-mediated phospholipid efflux from cells. Abca7 may also mediate cholesterol efflux. Abca7 may regulate cellular ceramide homeostasis during keratinocytes differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ABCA1 Antibody -
BSA Free

NB400-105

Immunohistochemistry-Paraffin ABCA1 Antibody - BSA Free

(7 Reviews)

(419 Publications)

Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt

Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB

ABCB6 Antibody -
BSA Free

NBP3-41339

Immunohistochemistry-Paraffin ABCB6 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

Apolipoprotein
A-I/ApoA1 Antibody - ...

NBP2-52979

Western Blot Apolipoprotein A-I/ApoA1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence Apolipoprotein A-I/ApoA1 Antibody - BSA Free

(1 Review)

Species: Hu, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Apolipoprotein
E/ApoE Antibody (WUE- ...

NB110-60531

Western Blot Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free

Flow Cytometry Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free

(2 Reviews)

(42 Publications)

Species: Hu, Mu, Rt(-)

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB

Clusterin/APOJ
Antibody [Unconjugate

AF2747

Western Blot Clusterin/APOJ Antibody [Unconjugated]

(14 Publications)

Species: Mu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB

Siglec-3/CD33
Antibody (44M12D3) - ...

NBP2-22377

Immunohistochemistry-Paraffin Siglec-3/CD33 Antibody (44M12D3) - BSA Free

(4 Publications)

Species: Hu

Applications: IHC, IHC-P, WB

ABCA4 Antibody
(3F4) - Azide Free

NBP1-30032

Immunohistochemistry ABCA4 Antibody (3F4) - Azide Free

(1 Review)

(5 Publications)

Species: Bv, Ca, Fe, Hu, Mu, Xp

Applications: ICC/IF, IHC, IHC-Fr, KO, WB

PICALM Antibody -
BSA Free

NBP1-86658

(7 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

EphA1 Antibody
[Unconjugated]

AF638

Immunocytochemistry EphA1 Antibody [Unconjugated]

(5 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, ICC, WB

beta Amyloid
Antibody (MOAB-2) - B ...

NBP2-13075

Immunohistochemistry beta Amyloid Antibody (MOAB-2) - BSA Free

Immunocytochemistry/ Immunofluorescence beta Amyloid Antibody (MOAB-2) - BSA Free

(2 Reviews)

(75 Publications)

Species: Ba, Hu, Pm, Mu, Rt

Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB

ABCG1 Antibody -
BSA Free

NB400-132

(2 Reviews)

(186 Publications)

Species: ChHa, Ha, Hu, Pm, Mu, Rb, Rt

Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, IP, In vitro, In vivo, Simple Western, WB

CD2AP Antibody -
BSA Free

NBP1-90625

Immunohistochemistry-Paraffin CD2AP Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

MRP1 Antibody
(IU2H10) - BSA Free

NB400-156

Western Blot MRP1 Antibody (IU2H10) - BSA Free

Immunocytochemistry/ Immunofluorescence MRP1 Antibody (IU2H10) - BSA Free

(17 Publications)

Species: Hu, Mu, Rt

Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB

BIN1 Antibody -
BSA Free

NBP1-89102

(2 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

ABCA2 Antibody

NBP1-20863

(3 Publications)

Species: Hu

Applications: IHC, IHC-P, IP, PEP-ELISA, WB

ABCA3 Antibody -
BSA Free

NBP1-89310

Species: Hu

Applications: ICC/IF, IHC, IHC-P

CD35 Antibody (E11)

NBP2-29460

(6 Publications)

Species: Pm, Pm-Cm, Hu, Pm, RM

Applications: Flow, ICC/IF, IHC, IHC-P, ISH

ABCG5 Antibody -
BSA Free

NBP1-80712

(5 Publications)

Species: Hu

Applications: ICC/IF

MS4A6A Antibody -
BSA Free

NBP2-82106

Immunohistochemistry MS4A6A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence MS4A6A Antibody - BSA Free

Species: Hu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

ABCA7 Antibody

NBP1-69064

Species: Mu, Hu, Rt, Bv, Ca, Gp

Applications: WB

Publications for ABCA7 Antibody (NBP1-69064) (0)

There are no publications for ABCA7 Antibody (NBP1-69064).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA7 Antibody (NBP1-69064) (0)

There are no reviews for ABCA7 Antibody (NBP1-69064). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCA7 Antibody (NBP1-69064) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional ABCA7 Products

Research Areas for ABCA7 Antibody (NBP1-69064)

Find related products by research area.

Blogs on ABCA7

There are no specific blogs for ABCA7, but you can read our latest blog posts.

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our ABCA7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol	ABCA7
Uniprot	Q91V24(Mouse)

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

ABCA7 Antibody

Species Glossary

Images

Product Details

Order Details

ABCA7 Antibody Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for ABCA7 Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for ABCA7 Antibody (NBP1-69064) (0)

Reviews for ABCA7 Antibody (NBP1-69064) (0)

Product General Protocols

Video Protocols

FAQs for ABCA7 Antibody (NBP1-69064) (0)

Secondary Antibodies

Isotype Controls

Additional ABCA7 Products

Research Areas for ABCA7 Antibody (NBP1-69064)

Blogs on ABCA7

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics