ABCA4 Antibody (H00000024-A01)

ABCA4 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 ml
 
Bulk Request
ABCA4 Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:ABCA4
Purity:Whole antisera
Host:Mouse
Specificity:ABCA4 - ATP-binding cassette, sub-family A (ABC1), member 4
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional ABCA4 Products
ABCA4 Antibody Details:
Immunogen:ABCA4 (NP_000341, 2174 a.a. ~ 2274 a.a) partial recombinant protein with GST tag.
Epitope:PKDDLLPDLNPVEQFFQGNFPGSVQRERHY NMLQFQVSSSSLARIFQLLLSHKDSLLIEE YSVTQTTLDQVFVNFAKQQTESHDLPLHPR AAGASRQAQD*
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Dilutions:ELISA, Western Blot 1:500
Unit Size:0.05 ml
Concentration:This product is unpurified. Concentration is not relevant.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol.
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: ABCA4
Entrez24 (Human)
OMIM153800|248200|601691|601718 (Human)
Swiss ProtNP_000341 (Human)
 
Background:

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This protein is a retina-specific ABC transporter with N-retinylidene-PE as a substrate. It is expressed exclusively in retina photoreceptor cells, indicating the gene product mediates transport of an essental molecule across the photoreceptor cell membrane. Mutations in this gene are found in patients diagnosed with Stargardt disease, a form of juvenile-onset macular degeneration. Mutations in this gene are also associated with retinitis pigmentosa-19, cone-rod dystrophy type 3, early-onset severe retinal dystrophy, fundus flavimaculatus, and macular degeneration age-related 2.

Jump to: Images, Ask a Question

Working with ABCA4

ABCA4 Antibody Images (1)
ABCA4 polyclonal antibody (A01), Lot # 051109JC01 Western Blot analysis of ABCA4 expression in SJCRH30 ( Cat # L027V1 ).
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about ABCA4? Ask us by using live chat or by submitting your questions below:

 
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCA4 Partial Recombinant ProteinH00000024-Q01HuELISA, WB(1)

Primary Antibodies (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCA4 Antibody (3F4)NBP1-30032Bv, Hu, Mu, XpIHC-Fr, IHC-P, WB(1)(4)

ABCA4 AntibodyPAB11617HuELISA

RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ABCA4 RNAiH00000024-R02Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

ABCA4 in Context


Research Areas related to ABCA4 (1):
Novus Explorer for ABCA4 gene

Try our bioinformatic tool that shows the relationships between ABCA4 and other genes, diseases, pathways and post-translational modifications.