6 Phosphofructo 2 Kinase Antibody (H00005209-A01)
6 Phosphofructo 2 Kinase Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-IPFK2 antibody, anti-PFK2 antibody, |
|
|
6 Phosphofructo 2 Kinase Antibody Summary: | | Gene: | PFKFB3 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | PFKFB3 - 6-phosphofructo-2-kinase/fruct ose-2,6-biphosphatase 3 |
|---|
| Publications: | Antibody has been mentioned in at least 2 Publications. |
|---|
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional 6 Phosphofructo 2 Kinase Products 6 Phosphofructo 2 Kinase Antibody Details: | Immunogen: | PFKFB3 (NP_004557, 412 a.a. ~ 521 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | CPLHTVLKLTPVAYGCRVESIYLNVESVCT HRERSEDAKKGPNPLMRRNSVTPLASPEPT KKPRINSFEEHVASTSAALPSCLPPEVPTQ LPGQNMKGSRSSADSSRKH* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
|
Images (1) Reviews (1) Related Products (15) Working with 6 Phosphofructo 2 Kinase
|
Jump to: Publications, Images, Reviews, Ask a Question
|
Working with 6 Phosphofructo 2 Kinase
6 Phosphofructo 2 Kinase Antibody Images (1) PFKFB3 polyclonal antibody (A01), Lot # 060626JCS1 Western Blot analysis of PFKFB3 expression in SJCRH30 ( Cat # L027V1 ). |
|
Reviewed by:
Amy Clem 8/11/2010
|
|
Application:
|
Western Blot
|
|
Sample Tested:
|
Hela cell lysate
|
|
Sample Loaded:
|
about 35ug
|
|
Species:
|
Human
|
|
Sample Pretreated:
|
Samples lysed with Pierce IP lysis buffer and passed through a needle and briefly sonicated.
|
|
Lot:
|
08268
|
|
Results:
|
Band at 54kD expected size becomes clearer with more use of antibody prep.
|
|
Blocking Buffer:
|
3% Milk
|
|
Concentration:
|
TBS-T .1%
|
|
Blocking Time:
|
i hour
|
|
Blocking Temperature:
|
room temp
|
|
Dilution Ratio:
|
1:500
|
|
Incubation Time:
|
overnight
|
|
Incubation Temperature:
|
4degrees Celsius
|
|
Incubation Dilution Buffer:
|
3% Milk in TBS-T
|
|
Description:
|
Pierce mouse
|
|
Manufacturer Catalog #:
|
31430
|
|
Dilution Ratio:
|
1:10000
|
|
Method:
|
ECL Plus
|
|
Exposure Time:
|
15 sec.
|
|
Positive Control:
|
none
|
|
Negative Control:
|
siRNA
|
|
Did you observe bands?:
|
Yes
|
|
Specific Bands:
|
54 kDa
|
|
Non-specific Bands:
|
some around 80 and 34 kDa
|
|
|
Publications (2)
|
|
|
Ask a Scientist
Can't find an answer to your question about 6 Phosphofructo 2 Kinase? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (8)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer
| 6 Phosphofructo 2 Kinase in Context
|
Novus Explorer for 6 Phosphofructo 2 Kinase gene
|
|
