14-3-3 zeta/delta Protein (NBC1-18406)
14-3-3 zeta/delta Protein
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein antibody, anti-zeta polypeptide antibody, anti-YWHAZ antibody, anti-MGC111427 antibody, anti-KCIP-1 antibody |
|
|
14-3-3 zeta/delta Protein Summary: | | | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional 14-3-3 zeta/delta Products 14-3-3 zeta/delta Protein Details: | Immunogen: | MRGSHHHHHHGMASMTGGQQMGRDLYDDDD KDRWGSHMDKNELVQKAKLAEQAERYDDMA ACMKSVTEQGAELSNEERNLLSVAYKNVVG ARRSSWRVVSSIEQKTEGAEKKQQMAREYR EKIETELRDICNDVLSLLEKFLIPNASQAE SKVFYLKMKGDYYRYLAEVAAGDDKKGIVD QSQQAYQEAFEISKKEMQPTHPIRLGLALN FSVFYYEILNSPEKACSLAKTAFDEAIAEL DTLSEESYKDSTLIM???? |
|---|
| Uses: | Useful in Western Blot |
|---|
| Dilutions: | Western Blot |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | 1.0 mg/ml |
|---|
|
Packaging: | Storage: | Store at -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Liquid in Phosphate Buffered Saline pH7.4 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The 14-3-3 family of proteins plays a key regulatory role in signal transduction, checkpoint control, apoptotic and nutrient-sensing pathways. 14-3-3 proteins are highly conserved and ubiquitously expressed. There are at least seven isoforms, ', ', ', ', ', ' and ' that have been identified in mammals. 14-3-3 zeta interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Recombinant human YWHAZ, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
|
Images (1) Reviews (0) Related Products (5) Exploring 14-3-3 zeta/delta Working with 14-3-3 zeta/delta
|
Jump to: Publications, Images, Ask a Question
|
Working with 14-3-3 zeta/delta
14-3-3 zeta/delta Protein Images (1) SDS-Page: 14-3-3 zeta/delta Protein [NBC1-18406] - 14-3-3 zeta, 32 kDa (245 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE |
|
|
|
Publications (2)14-3-3 zeta/delta Protein Background References:- Li FQ., et al.(2008). J Cell Biol. 181(7):1141-54.
- L Gannon-Murakami., et al. (2002). J. Biol. Chem., 277(26): 23116-23122
|
|
|
|
Ask a Scientist
Can't find an answer to your question about 14-3-3 zeta/delta? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Peptides and Proteins, Primary Antibodies
|
Related ProductsPeptides and ProteinsPrimary Antibodies (4)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| 14-3-3 zeta/delta Antibody | NBP1-61495 | Hu, Mu, Rt | ELISA, IF, IHC, WB | (3) | | | | | 14-3-3 zeta/delta Antibody | NB100-92268 | Hu, Mu | ELISA, IF, IHC-P, WB | (2) | | | | | 14-3-3 zeta/delta Antibody (EPR6379) | NBP1-95196 | Hu, Mu, Rt | WB | (1) | | | | | 14-3-3 zeta/delta Antibody | NBP1-35259 | Hu, Mu, Rt | IHC-P | | | | |
|
Jump to: Novus Explorer, Research Areas
| 14-3-3 zeta/delta in Context
Research Areas related to 14-3-3 zeta/delta (1): |
|
Novus Explorer for 14-3-3 zeta/delta gene
|
|
