Home » 14-3-3 zeta » 14-3-3 zeta Proteins » Recombinant Human 14-3-3 zeta Protein

We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Register on R&D Systems

Recombinant Human 14-3-3 zeta Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related 14-3-3 zeta Peptides and Proteins

Order Details


    • Catalog Number
      H00007534-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human 14-3-3 zeta Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 51-150 of Human YWHAZ partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQ
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
YWHAZ

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
This antibody is useful for ELISA and Western Blot. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 14-3-3 zeta Protein

  • 1433 zeta
  • 14-3-3 zeta
  • KCIP-1
  • KCIP-1MGC126532,14-3-3-zeta
  • MGC111427
  • MGC138156
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, deltapolypeptide
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zetapolypeptide
  • YWHAZ
  • zeta polypeptide

Background

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Two transcript variants differing in the 5' UTR, but encoding the same protein, have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLA2G2A Antibody
[Unconjugated]
AF4925
Western Blot PLA2G2A Antibody [Unconjugated]
Immunohistochemistry PLA2G2A Antibody [Unconjugated]
Simple Western PLA2G2A Antibody [Unconjugated]
Species: Mu
Applications: IHC, Simple Western, WB
PLA2G6 Antibody -
BSA Free
NBP3-46465
Western Blot PLA2G6 Antibody - BSA Free
Immunohistochemistry PLA2G6 Antibody - BSA Free
Species: Hu, Mu
Applications: ELISA, IHC, WB
PLA2G1B Antibody
(630823)
MAB5018
Western Blot PLA2G1B Antibody (630823)
Species: Hu
Applications: IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(850 Publications)
Species: Hu
Applications: BA
TEAD1 Antibody -
BSA Free
NBP2-94035
Chromatin Immunoprecipitation TEAD1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TEAD1 Antibody - BSA Free
Western Blot TEAD1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
DBT Antibody - BSA
Free
NBP1-89522
Immunohistochemistry-Paraffin DBT Antibody - BSA Free
Immunohistochemistry-Paraffin DBT Antibody - BSA Free
Immunohistochemistry-Paraffin DBT Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
PLA2G4A Antibody -
BSA Free
NBP1-31344
Immunocytochemistry/ Immunofluorescence PLA2G4A Antibody - BSA Free
Immunohistochemistry-Paraffin PLA2G4A Antibody - BSA Free
Western Blot PLA2G4A Antibody - BSA Free
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(58 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
IL-1 beta/IL-1F2
[Unconjugated]
201-LB
SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]
Bioactivity IL-1 beta/IL-1F2 [Unconjugated]
SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]
(643 Publications)
Species: Hu
Applications: BA

Kininogen/Kininostatin ...
AF1396
Kininogen/Kininostatin/Bradykinin Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: WB
Phospholipase B1
Antibody - Azide and ...
H00151056-B01P
Western Blot Phospholipase B1 Antibody - Azide and BSA Free
(1 Publication)
Species: Hu, Mu
Applications: WB
TIP60 Antibody -
BSA Free
NBP1-85482
Immunocytochemistry/ Immunofluorescence TIP60 Antibody - BSA Free
Western Blot TIP60 Antibody - BSA Free
Immunohistochemistry-Paraffin TIP60 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(716 Publications)
Species: Mu
Applications: ELISA
5-Lipoxygenase
Antibody - BSA Free
NB110-58748
Western Blot 5-Lipoxygenase Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence 5-Lipoxygenase Antibody - BSA Free
Knockdown Validated 5-Lipoxygenase Antibody - BSA Free
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Western Blot COX-2 Antibody
Western Blot COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB

Endorepellin/Perlecan/ ...
AF2364
Immunohistochemistry Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: IHC, WB
Recombinant Human
14-3-3 zeta Protein
H00007534-Q01
Recombinant Human 14-3-3 zeta Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01) (0)

There are no publications for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01) (0)

There are no reviews for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 14-3-3 zeta Products

Research Areas for 14-3-3 zeta Partial Recombinant Protein (H00007534-Q01)

Find related products by research area.

Blogs on 14-3-3 zeta

There are no specific blogs for 14-3-3 zeta, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 14-3-3 zeta Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol YWHAZ
OMIM