14-3-3 tau Protein (NBC1-18393)

14-3-3 tau Protein

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
14-3-3 tau Protein Summary:
Species:Hu
Protein Type:Full length Protein
Applications:WB
Gene:YWHAQ
Purity:Protein
 
Publications:Antibody has at least 1 Background Reference.
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional 14-3-3 tau Products
14-3-3 tau Protein Details:
Immunogen:MEKTELIQKAKLAEQAERYDDMATCMKAVT EQGAELSNEERNLLSVAYKNVVGGRRSAWR VISSIEQKTDTSDKKLQLIKDYREKVESEL RSICTTVLELLDKYLIANATNPESKVFYLK MKGDYFRYLAEVACGDDRKQTIDNSQGAYQ EAFDISKKEMQPTHPIRLGLALNFSVFYYE ILNNPELACTLAKTAFDEAIAELDTLNEDS YKDSTLIMQLLRDNLTLWTSDSAGEECDAA EGAEN
Species Reactivity:

Human.

Applications:
Uses:Useful in Western Blot
Dilutions:Western Blot
Unit Size:0.1 mg
Concentration:1.0 mg/ml
Packaging:
Storage:Store at -80 °C. Avoid freeze-thaw cycles.
Buffer:In 20mM Tris pH7.5
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: YWHAQ
Swiss ProtNP_006817 (Human)
 
Background:

The 14-3-3 family of proteins plays a key regulatory role in signal transduction, checkpoint control, apoptotic and nutrient-sensing pathways. 14-3-3 proteins are highly conserved and ubiquitously expressed. There are at least seven isoforms, ', ', ', ', ', ' and ' that have been identified in mammals. The 14-3-3 tau, a subtype of the 14-3-3 family of proteins, was found in T Cells, brain and testes. This 14-3-3 tau is upregulated in patients with amyotrophic lateral sclerosis. Recombinant human YWHAQ was expressed in E.coli and purified by using conventional chromatography techniques.

Jump to: Publications, Images, Ask a Question

Working with 14-3-3 tau

14-3-3 tau Protein Images (1)
SDS-Page: 14-3-3 Tau Protein [NBC1-18393] - 14-3-3 tau, 27 kDa (245 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Publications (1)

14-3-3 tau Protein Background References:

  1. Liu YC , et al. (1996) J Biol Chem; 271: 14591-5Xiao B , et al. (1995) Nature, 376; 188-191

Ask a Scientist

Can't find an answer to your question about 14-3-3 tau? Ask us by using live chat or by submitting your questions below:

 
Jump to: Primary Antibodies

Related Products

Primary Antibodies (4)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
14-3-3 tau AntibodyNBP1-06008Ca, Hu, Mu, RtPEP-ELISA, WB(1)(1)

14-3-3 tau Antibody (3B9)NB600-990Bv, Hu, Mu, RtIP, WB(5)

14-3-3 tau Antibody (AT1A1)NBP1-21301HuELISA, WB(1)(1)

14-3-3 tau AntibodyNBP1-31537HuWB(1)


Jump to: Novus Explorer

14-3-3 tau in Context


Novus Explorer for 14-3-3 tau gene

Try our bioinformatic tool that shows the relationships between YWHAQ and other genes, diseases, pathways and post-translational modifications.