Home » 14-3-3 sigma/Stratifin » 14-3-3 sigma/Stratifin Proteins » Recombinant Human 14-3-3 sigma/Stratifin Protein

We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Register on R&D Systems

Recombinant Human 14-3-3 sigma/Stratifin Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related 14-3-3 sigma/Stratifin Peptides and Proteins

Order Details


    • Catalog Number
      H00002810-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human 14-3-3 sigma/Stratifin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-248 of Human SFN full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKAETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SFN

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 14-3-3 sigma/Stratifin Protein

  • 14-3-3 protein sigma
  • 1433 sigma
  • 14-3-3 sigma
  • Epithelial cell marker protein 1
  • HME1
  • SFN
  • stratifin
  • YWHAS

Background

SFN( AAH02995, 1 a.a. - 249 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Nrf2 Antibody -
BSA Free
NBP1-32822
Western Blot Nrf2 Antibody - BSA Free
Western Blot Nrf2 Antibody - BSA Free
Western Blot Nrf2 Antibody - BSA Free
(4 Reviews)
(77 Publications)
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(45 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
Western Blot p21/CIP1/CDKN1A Antibody (WA-1)
Western Blot p21/CIP1/CDKN1A Antibody (WA-1)
(26 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
GABPA Antibody -
BSA Free
NBP1-32105
Immunocytochemistry/ Immunofluorescence GABPA Antibody - BSA Free
Immunoprecipitation GABPA Antibody - BSA Free
Immunohistochemistry-Paraffin GABPA Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Species: Hu
Applications: IHC,  IHC-P, WB
D4S234E Antibody
(1C3) - Azide and BSA ...
H00027065-M01
Sandwich ELISA D4S234E Antibody (1C3) - Azide and BSA Free
Western Blot D4S234E Antibody (1C3) - Azide and BSA Free
Western Blot D4S234E Antibody (1C3) - Azide and BSA Free
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
MMP-1 Antibody
(36665) [Unconjugated
MAB901
Knockout Validated MMP-1 Antibody (36665) [Unconjugated]
Immunohistochemistry MMP-1 Antibody (36665) [Unconjugated]
Immunohistochemistry MMP-1 Antibody (36665) [Unconjugated]
(45 Publications)
Species: Hu
Applications: IHC, IP, KO, Neut, WB
14-3-3 Antibody -
BSA Free
NBP2-27202
Simple Western 14-3-3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence 14-3-3 Antibody - BSA Free
Western Blot 14-3-3 Antibody - BSA Free
(1 Review)
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(850 Publications)
Species: Hu
Applications: BA
Bcl-2 Antibody -
BSA Free
NB100-56098
Western Blot Bcl-2 Antibody - BSA Free
Western Blot Bcl-2 Antibody - BSA Free
Western Blot Bcl-2 Antibody - BSA Free
(2 Reviews)
(28 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
PAK3 Antibody
[Unconjugated]
AF6897
Western Blot PAK3 Antibody [Unconjugated]
Immunohistochemistry PAK3 Antibody [Unconjugated]
Immunohistochemistry PAK3 Antibody [Unconjugated]
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Cyclin B1 Antibody
[Unconjugated]
AF6000
Immunohistochemistry Cyclin B1 Antibody [Unconjugated]
Western Blot Cyclin B1 Antibody [Unconjugated]
Simple Western Cyclin B1 Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: IHC, Simple Western, WB
HO-1/HMOX1/HSP32
Antibody (HO-1-1) - B ...
NBP1-97507
Flow Cytometry HO-1/HMOX1/HSP32 Antibody (HO-1-1) - BSA Free
Immunohistochemistry-Paraffin HO-1/HMOX1/HSP32 Antibody (HO-1-1) - BSA Free
Western Blot HO-1/HMOX1/HSP32 Antibody (HO-1-1) - BSA Free
(1 Review)
(20 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(52 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
ERK1 [p Thr202, p
Tyr204] [Biotin]
DYC1825-2
N/A ERK1 [p Thr202, p Tyr204] [Biotin]
N/A ERK1 [p Thr202, p Tyr204] [Biotin]
N/A ERK1 [p Thr202, p Tyr204] [Biotin]
(12 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(11 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
Aminopeptidase
N/CD13 Antibody [Unco ...
AF2335
Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
(62 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Recombinant Human
14-3-3 sigma/Stratifi ...
H00002810-P01
Recombinant Human 14-3-3 sigma/Stratifin Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for 14-3-3 sigma/Stratifin Recombinant Protein (H00002810-P01) (0)

There are no publications for 14-3-3 sigma/Stratifin Recombinant Protein (H00002810-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 14-3-3 sigma/Stratifin Recombinant Protein (H00002810-P01) (0)

There are no reviews for 14-3-3 sigma/Stratifin Recombinant Protein (H00002810-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 14-3-3 sigma/Stratifin Recombinant Protein (H00002810-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 14-3-3 sigma/Stratifin Products

Research Areas for 14-3-3 sigma/Stratifin Recombinant Protein (H00002810-P01)

Find related products by research area.

Blogs on 14-3-3 sigma/Stratifin

There are no specific blogs for 14-3-3 sigma/Stratifin, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 14-3-3 sigma/Stratifin Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SFN