14-3-3 gamma Protein (NBC1-18391)
14-3-3 gamma Protein
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-tyrosine 3-monooxygenase/ tryptophan 5-monooxygenase activation protein antibody, anti-YWHAG antibody, anti-gamma polypeptide antibody, |
|
|
14-3-3 gamma Protein Summary: | | | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional 14-3-3 gamma Products 14-3-3 gamma Protein Details: | Immunogen: | MVDREQLVQKARLAEQAERYDDMAAAMKNV TELNEPLSNEERNLLSVAYKNVVGARRSSW RVISSIEQKTSADGNEKKIEMVRAYREKIE KELEAVCQDVLSLLDNYLIKNCSETQYESK VFYLKMKGDYYRYLAEVATGEKRATVVESS EKAYSEAHEISKEHMQPTHPIRLGLALNYS VFYYEIQNAPEQACHLAKTAFDDAIAELDT LNEDSYKDSTLIMQLLRDNLTLWTSDQQDD DGGEGNN |
|---|
| Uses: | Useful in Western Blot |
|---|
| Dilutions: | Western Blot |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | 1.0 mg/ml |
|---|
|
Packaging: | Storage: | Store at -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 20mM Tris 7.5 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The 14-3-3 family of proteins plays a key regulatory role in signal transduction, checkpoint control, apoptotic and nutrient-sensing pathways. 14-3-3 proteins are highly conserved and ubiquitously expressed. There are at least seven isoforms, ', ', ', ', ', ' and ' that have been identified in mammals. The 14-3-3gamma, a subtype of the 14-3-3 family of proteins, was thought to be brain and neuron-specific. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways. Recombinant human 14-3-3 ' was expressed in E.coli and purified by using conventional chromatography techniques.
|
Images (1) Reviews (0) Related Products (21) Exploring 14-3-3 gamma Working with 14-3-3 gamma
|
Jump to: Publications, Images, Ask a Question
|
Working with 14-3-3 gamma
14-3-3 gamma Protein Images (1) SDS-Page: 14-3-3 gamma Protein [NBC1-18391] - 14-3-3 gamma, 28 kDa ( 247 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE |
|
|
|
Publications (2)14-3-3 gamma Protein Background References:- Chen XQ, Yu AC, et al. (2002) J Biochem. 23;296(3):657-63
- Chen XQ, et al. (2005) Glia. 42(4):315-24
|
|
|
|
Ask a Scientist
Can't find an answer to your question about 14-3-3 gamma? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi
|
Related ProductsLysates (1)Peptides and ProteinsPrimary Antibodies (15)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| 14-3-3 gamma Antibody (HS23) | NB100-407 | Bv, Ch, Hu, Mu, Rt, Ze | ICC, IF, WB | (2) | (1) | | | | 14-3-3 gamma Antibody (KC21) | NB100-406 | Hu | WB | (1) | (3) | | | | 14-3-3 gamma Antibody (6A10) | H00007532-M02 | Hu | ELISA, WB | (6) | | | | | 14-3-3 gamma Antibody | NBP1-19694 | Hu, Mu, Rt | IF, IHC-P, WB | (2) | | | | | 14-3-3 gamma Antibody | NBP1-68207 | Hu, Mu, Rt | ELISA, IF, IHC, WB | | | | | | ... and 10 more. See All » |
RNAi (1)
|
Jump to: Novus Explorer, Research Areas
| 14-3-3 gamma in Context
Research Areas related to 14-3-3 gamma (4): |
|
Novus Explorer for 14-3-3 gamma gene
|
|
