Home » 14-3-3 gamma » 14-3-3 gamma Proteins » Recombinant Human 14-3-3 gamma Protein

We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Register on R&D Systems

Recombinant Human 14-3-3 gamma Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related 14-3-3 gamma Peptides and Proteins

Order Details


    • Catalog Number
      H00007532-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human 14-3-3 gamma Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 67-166 of Human YWHAG partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQ
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
YWHAG

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 14-3-3 gamma Protein

  • 1433 gamma
  • 14-3-3 gamma
  • 14-3-3 protein gamma
  • 14-3-3GAMMA
  • KCIP-1
  • Protein kinase C inhibitor protein 1
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gammapolypeptide
  • YWHAG

Background

YWHAG - tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

14-3-3 Antibody -
BSA Free
NBP2-27202
Simple Western 14-3-3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence 14-3-3 Antibody - BSA Free
Western Blot 14-3-3 Antibody - BSA Free
(1 Review)
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
Tyrosine
Hydroxylase Antibody ...
NB300-109
Immunohistochemistry-Frozen Tyrosine Hydroxylase Antibody - Azide Free
Immunohistochemistry Tyrosine Hydroxylase Antibody - Azide Free
Immunohistochemistry Tyrosine Hydroxylase Antibody - Azide Free
(7 Reviews)
(252 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
14-3-3 zeta
Antibody (818515) [Un ...
MAB2669
Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]
Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]
Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]
(2 Reviews)
(1 Publication)
Species: Hu
Applications: IHC, Simple Western, WB
Chk1 Antibody -
BSA Free
NB100-464
Immunoprecipitation Chk1 Antibody - BSA Free
Immunohistochemistry-Paraffin Chk1 Antibody - BSA Free
Western Blot Chk1 Antibody - BSA Free
(13 Publications)
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
14-3-3 epsilon
Antibody - BSA Free
NBP1-89827
Western Blot 14-3-3 epsilon Antibody - BSA Free
Western Blot 14-3-3 epsilon Antibody - BSA Free
Immunohistochemistry-Paraffin 14-3-3 epsilon Antibody - BSA Free
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
ERK1 [p Thr202, p
Tyr204] [Biotin]
DYC1825-2
N/A ERK1 [p Thr202, p Tyr204] [Biotin]
N/A ERK1 [p Thr202, p Tyr204] [Biotin]
N/A ERK1 [p Thr202, p Tyr204] [Biotin]
(12 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(45 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(52 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
PIK3CA Antibody -
BSA Free
NBP2-19804
Immunocytochemistry/ Immunofluorescence PIK3CA Antibody - BSA Free
Western Blot PIK3CA Antibody - BSA Free
Western Blot PIK3CA Antibody - BSA Free
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(6 Publications)
Species: Hu
Applications: WB
PI 3-Kinase p110
gamma Antibody - BSA ...
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody - BSA Free
Western Blot PI 3-Kinase p110 gamma Antibody - BSA Free
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody - BSA Free
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
GM-CSF
[Unconjugated]
7954-GM/CF
Bioactivity GM-CSF [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
PI 3-Kinase p110
delta Antibody (OTI1D ...
NBP2-46404
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
LAMC2 Antibody
(CL2980) - BSA Free
NBP2-42388
Western Blot LAMC2 Antibody (CL2980) - BSA Free
Immunohistochemistry-Paraffin LAMC2 Antibody (CL2980) - BSA Free
Immunohistochemistry-Paraffin LAMC2 Antibody (CL2980) - BSA Free
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
CDC25C Antibody
(461908) [Unconjugate
MAB4459
Western Blot CDC25C Antibody (461908) [Unconjugated]
Western Blot CDC25C Antibody (461908) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB
IL-3 [Unconjugated]
203-IL
SDS-PAGE IL-3 [Unconjugated]
Bioactivity IL-3 [Unconjugated]
SEC-MALS IL-3 [Unconjugated]
(228 Publications)
Species: Hu
Applications: BA

Publications for 14-3-3 gamma Partial Recombinant Protein (H00007532-Q01) (0)

There are no publications for 14-3-3 gamma Partial Recombinant Protein (H00007532-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 14-3-3 gamma Partial Recombinant Protein (H00007532-Q01) (0)

There are no reviews for 14-3-3 gamma Partial Recombinant Protein (H00007532-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 14-3-3 gamma Partial Recombinant Protein (H00007532-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 14-3-3 gamma Products

Research Areas for 14-3-3 gamma Partial Recombinant Protein (H00007532-Q01)

Find related products by research area.

Blogs on 14-3-3 gamma

There are no specific blogs for 14-3-3 gamma, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 14-3-3 gamma Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol YWHAG