14-3-3 epsilon Protein (NBC1-18392)
14-3-3 epsilon Protein
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-tyrosine 3-monooxygenase/ tryptophan 5-monooxygenase activation protein antibody, anti-YWHAE antibody, anti-MDS antibody, anti-MDCR antibody, anti-KCIP-1 antibody, anti-FLJ45465 antibody, anti-epsilon polypeptide antibody |
|
|
14-3-3 epsilon Protein Summary: | | | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional 14-3-3 epsilon Products 14-3-3 epsilon Protein Details: | Immunogen: | MDDREDLVYQAKLAEQAERYDEMVESMKKV AGMDVELTVEERNLLSVAYKNVIGARRASW RIISSIEQKEENKGGEDKLKMIREYRQMVE TELKLICCDILDVLDKHLIPAANTGESKVF YYKMKGDYHRYLAEFATGNDRKEAAENSLV AYKAASDIAMTELPPTHPIRLGLALNFSVF YYEILNSPDRACRLAKAAFDDAIAELDTLS EESYKDSTLIMQLLRDNLTLWTSDMQGDGE EQNKEALQDVEDENQ |
|---|
| Uses: | Useful in Western Blot |
|---|
| Dilutions: | Western Blot |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | 1.0 mg/ml |
|---|
|
Packaging: | Storage: | Store at -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 20mM Tris pH7.5 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The 14-3-3 family of proteins plays a key regulatory role in signal transduction, checkpoint control, apoptotic and nutrient-sensing pathways. 14-3-3 proteins are highly conserved and ubiquitously expressed. There are at least seven isoforms, ', ', ', ', ', ' and ' that have been identified in mammals. The 14-3-3 epsilon, a subtype of the 14-3-3 family of proteins, was thought to be brain and neuron-specific. It has been shown to interact with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Recombinant human 14-3-3 ' was expressed in E.coli and purified by using conventional chromatography techniques.
|
Images (1) Reviews (0) Related Products (15) Exploring 14-3-3 epsilon Working with 14-3-3 epsilon
|
Jump to: Publications, Images, Ask a Question
|
Working with 14-3-3 epsilon
14-3-3 epsilon Protein Images (1) SDS-Page: 14-3-3 epsilon Protein [NBC1-18392] - 14-3-3 epsilon, 29 kDa (255 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE |
|
|
|
Publications (1)14-3-3 epsilon Protein Background References:- Oriente F, et al.(2005) J Biol Chem. ;280(49):40642-9.Conklin D, et al.(2005) PNAS ,92(17):7892-7896
|
|
|
|
Ask a Scientist
Can't find an answer to your question about 14-3-3 epsilon? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Peptides and Proteins, Primary Antibodies, RNAi
|
Related ProductsPeptides and ProteinsPrimary Antibodies (8)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| 14-3-3 epsilon Antibody (EPR3919) | NBP1-95309 | Hu, Mu, Rt | FACS, ICC, IF, WB | (2) | | | | | 14-3-3 epsilon Antibody | NBP1-89827 | Hu | IF, IHC-P, WB | (3) | | | | | 14-3-3 epsilon Antibody | NBP1-32695 | Hu | ICC, IF, IHC-P, WB | (3) | | | | | 14-3-3 epsilon Antibody (EPR3918) | NBP1-40780 | Hu, Mu, Rt | FACS, ICC, WB | (2) | | | | | 14-3-3 epsilon Antibody | NB100-92415 | Hu, Mu, Rt | ELISA, WB | (1) | | | | | ... and 3 more. See All » |
RNAi (2)
|
Jump to: Novus Explorer, Research Areas
| 14-3-3 epsilon in Context
Research Areas related to 14-3-3 epsilon (2): |
|
Novus Explorer for 14-3-3 epsilon gene
|
|
