14-3-3 beta/alpha Antibody (H00007529-A01)
14-3-3 beta/alpha Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-GW128 antibody, anti-KCIP-1 antibody, anti-HS1 antibody |
|
|
14-3-3 beta/alpha Antibody Summary: | | Gene: | YWHAB |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | YWHAB - tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional 14-3-3 beta/alpha Products 14-3-3 beta/alpha Antibody Details: | Immunogen: | YWHAB (AAH01359, 1 a.a. ~ 247 a.a) full length recombinant protein with GST tag. |
|---|
| Epitope: | MTMDKSELVQKAKLAEQAERYDDMAAAMKA VTEQGHELSNEERNLLSVAYKNVVGARRSS WRVISSIEQKTERNEKKQQMGKEYREKIEA ELQDICNDVLELLDKYLIPNATQPESKVFY LKMKGDYFRYLSEVASGDNKQTTVSNSQQA YQEAFEISKKEMQPTHPIRLGLALNFSVFY YEILNSPEKACSLAKTAFDEAIAELDTLNE ESYKDSTLIMQLLRDNLTLWTSENQGDEGD AGEGEN* |
|---|
Human. Other species not tested. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500 |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene.
|
Reviews (0) Related Products (21) Exploring 14-3-3 beta/alpha
|
Jump to: Ask a Question
|
Working with 14-3-3 beta/alpha
14-3-3 beta/alpha Antibody Images (0)
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about 14-3-3 beta/alpha? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (11)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| 14-3-3 beta/alpha Antibody (Y62) | NB110-55434 | Hu, Mu, Rt | FACS, ICC, IHC-P, IP, WB | (3) | (1) | | | | 14-3-3 beta/alpha Antibody (E58) | NB110-55435 | Hu, Mu, Rt | FACS, IHC-P, WB | (3) | (2) | | | | 14-3-3 beta/alpha Antibody | NBP1-35254 | Hu, Mu, Rt | IHC-P, WB | (1) | | | | | 14-3-3 beta/alpha Antibody | NBP1-33454 | Hu | IF, WB | (2) | | | | | 14-3-3 beta/alpha Antibody (2G6-3F2) | H00007529-M01 | Hu | ELISA, IF, WB | (2) | | | | | ... and 6 more. See All » |
RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| 14-3-3 beta/alpha in Context
Research Areas related to 14-3-3 beta/alpha (1): |
|
Novus Explorer for 14-3-3 beta/alpha gene
|
|
