14-3-3 beta Protein (NBC1-18405)

14-3-3 beta Protein

This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

14-3-3 beta Protein Summary:

Species:	Hu
Protein Type:	Full length Protein
Applications:	WB

Gene:	YWHAQ
Purity:	Protein

Specificity:	This protein is from amino acids 1-246
Publications:	Antibody has at least 1 Background Reference.

Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.

View Additional 14-3-3 beta Products

Peptides and Proteins	Primary Antibodies

» View all 14-3-3 beta Related Products

14-3-3 beta Protein Details:

Immunogen:	MTMDKSELVQKAKLAEQAERYDDMAAAMKA VTEQGHELSNEERNLLSVAYKNVVGARRSS WRVISSIEQKTERNEKKQQMGKEYREKIEA ELQDICNDVLELLDKYLIPNATQPESKVFY LKMKGDYFRYLSEVASGDNKQTTVSNSQQA YQEAFEISKKEMQPTHPIRLGLALNFSVFY YEILNSPEKACSLAKTAFDEAIAELDTLNE ESYKDSTLIMQLLRDNLTLWTSENQGDEGD AGEGEN

Species Reactivity:

Human.

Applications:

Uses:	Useful in Western Blot
Dilutions:	Western Blot
Unit Size:	0.1 mg
Concentration:	1.0 mg/ml

Packaging:

Storage:	Store at -80 °C. Avoid freeze-thaw cycles.
Buffer:	Liquid in 20mM Tris pH 8.0, 1mM EDTA, 50mM NaCl
Preservative:	No Preservative
Limitations:	This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.

Gene Symbol: YWHAQ

Swiss Prot	NP_003395 (Human)

Background:

The 14-3-3 family plays a key regulatory role in signal transduction, checkpoint control, apoptotic and nutrient-sensing pathways. 14-3-3 proteins are highly conserved and ubiquitously expressed. There are at least seven isoforms: beta, gamma, epsilon, sigma, zeta, tau, and eta that have been identified in mammals. The 14-3-3 beta, a subtype of the 14-3-3 proteins, was found in B Cells, brain and liver etc. This 14-3-3 beta has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Recombinant human 14-3-3 beta was expressed in E.coli and purified by using conventional chromatography techniques.

Images (1)

See all images...

Reviews (0)

Be the first to review this product for a reward!

Working with 14-3-3 beta

14-3-3 beta Protein Images (1)

SDS-Page: 14-3-3 Beta Protein [NBC1-18405] - 14-3-3 beta, 28 kDa (246 aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE

Reviews (0) Have you used this product? Review this product to earn Novus Rewards.

Publications (1)

14-3-3 beta Protein Background References:

Rodriguez LG., et al. (2005). J Cell Physiol. Jan; 202(1):285-94.Mils V., et al.(2000). Oncogene. Mar 2; 19(10):1257-65.

Protocols

All General Protocols

Ask a Scientist

Can't find an answer to your question about 14-3-3 beta? Ask us by using live chat or by submitting your questions below:

Jump to: Primary Antibodies

Related Products

Primary Antibodies (4)

Name	Catalog#	Reactivity	Applications	Images	Publications
14-3-3 beta Antibody	NBP1-80611	Hu	IF, IHC-P, WB	(3)
14-3-3 beta Antibody	NBP1-72185	Hu, Mu, Rt	ELISA, IHC-P, IP, WB	(2)	(1)
14-3-3 beta Antibody	NBP1-79931	Bv, Ch, Hu, Mu, Rt	WB
14-3-3 beta Antibody	PAB11171	Hu, Mu, Rt	IHC-P

Jump to: Novus Explorer
14-3-3 beta in Context
Novus Explorer for 14-3-3 beta gene