12 Lipoxygenase Antibody (H00000239-A01)
12 Lipoxygenase Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-LOG12 antibody, |
|
|
12 Lipoxygenase Antibody Summary: | | Gene: | ALOX12 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ALOX12 - arachidonate 12-lipoxygenase |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional 12 Lipoxygenase Products 12 Lipoxygenase Antibody Details: | Immunogen: | ALOX12 (NP_000688, 564 a.a. ~ 664 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | PPPTTKEDVTMATVMGSLPDVRQACLQMAI SWHLSRRQPDMVPLGHHKEKYFSGPKPKAV LNQFRTDLEKLEKEITARNEQLDWPYEYLK PSCIENSVTI* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
|
Images (1) Reviews (0) Related Products (13) Exploring 12 Lipoxygenase
|
Jump to: Images, Ask a Question
|
Working with 12 Lipoxygenase
12 Lipoxygenase Antibody Images (1) ALOX12 polyclonal antibody (A01), Lot # 051214JC01 Western Blot analysis of ALOX12 expression in HepG2 ( Cat # L019V1 ). |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about 12 Lipoxygenase? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (2)Peptides and ProteinsPrimary Antibodies (7)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| 12 Lipoxygenase in Context
Research Areas related to 12 Lipoxygenase (1): |
|
Novus Explorer for 12 Lipoxygenase gene
|
|
